Waiting
Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biology

הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור

Published: July 16, 2013 doi: 10.3791/50443

Summary

Ca אינטר

Abstract

תקשורת בין תאית היא חיונית לתיאום של תהליכים פיסיולוגיים בין תאים במגוון רחב של איברים ורקמות, ובכלל זה המוח, הכבד, הרשתית, השבלול וכלי הדם. בהגדרות ניסוי, אינטר Ca 2 + גלים יכול להיות שהושרו על ידי יישום גירוי מכאני לתא בודד. זה מוביל לשחרור של מולקולות האיתות תאיות IP 3 ו Ca 2 + שיזמו את ההתפשטות של Ca 2 + גל מעגלי מתא מגורה מכאני לתאים השכנים. את המסלולים המולקולריים המרכזיים השולטים 2 התפשטות אינטר + גל Ca מסופקים על ידי ערוצי צומת פער עד להעברה הישירה של 3-IP ועל ידי hemichannels דרך שחרורו של ה-ATP. זיהוי והאפיון של המאפיינים והרגולציה של connexin שונה וisoforms pannexin כערוצי צומת גאפ וhemichannels מותר על ידי quantification של התפשטות Ca אינטר 2 + גל, siRNA, ושימוש במעכבים של ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידה אינטר Ca 2 + גל בmonolayers של תאי האנדותל בקרנית עיקריים עמוסים Fluo4-AM בתגובה לגירוי מכאני מבוקר ומקומי עורר על ידי עיוות חריפה, קצר טווח של התא כתוצאה נגיעה של קרום התא עם micropipette זכוכית micromanipulator שליטה בקוטר קצה מיקרומטר פחות מ 1. אנו גם מתארים את הבידוד של תאים ראשוניים שור קרנית האנדותל והשימוש בו כמערכת מודל להערכת פעילות Cx43-hemichannel ככוח מונע לאינטר Ca 2 + גלים דרך שחרורו של ה-ATP. לבסוף, אנו דנים בשימוש, יתרונות, מגבלות וחלופות של שיטה זו בהקשר של ערוץ צומת פער ומחקר hemichannel.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

תקשורת בין תאית ואיתות חיונית לתיאום של תהליכים פיסיולוגיים בתגובה לאגוניסטים תאיים ברמה 1,2 כל האיבר והרקמה. הדרך הישירה ביותר של תקשורת בין תאית נוצרה על ידי ההתרחשות של צמתים פער. צמתים פער הם לוחות של ערוצי צומת גאפ, שהם ערוצים חלבוניים שהוקמו על ידי העגינה הראש בראש של שתי connexin (CX) hemichannels של תאים סמוכים 3,4 (איור 1). צמתים פער לאפשר המעבר של מולקולות איתות קטנות עם משקל מולקולרי של פחות מ -1.5 kDa, כולל Ca 2 + או ה-IP של 3 5, מה שגרם וויסות Ca 2 + שחרור מהחנויות תאיות של התאים השכנים 6 (איור 2). ערוצי צומת פער מוסדרים היטב על ידי אינטראקציות חלבון ותוך מולקולאריים ועל ידי תהליכי איתות תאיים, כמו שינוי והחיזורזירחון 7. GJS להקל על התגובה מתואמת של תאים מחוברים, ובכך מתנהג כמו כימי וsyncytium חשמל. לדוגמה, הפצה של פוטנציאל פעולת לב על פני myocytes פרוזדורים וחדרים מתווכת על ידי ערוצי 85 GJ מבוסס CX. CXS יש לא רק תפקיד כערוצי צומת פער, אלא גם ליצור hemichannels מזווג, ובכך מתפקד כערוצים בקרום בדומה לערוצים רגילים יון 8-10 (איור 1). Hemichannels להשתתף באיתות בין תאים שכנים paracrine על ידי שליטה בחילופי יונים ומולקולות איתות בין סביבת התוך תאית ו.

בסוגי תאים רבים (כמו תאי אפיתל, תאי osteoblastic, האסטרוציטים, תאי אנדותל, וכו ') ואיברים (כמו מוח, כבד, רשתית, שבלול וכלי דם), אינטר Ca 2 + גלים הם יסוד לתיאום של תגובות תאיות 2 + רמות תאיות בתא מסוים אינן מוגבלות לתא זה, אבל להפיץ לתאים השכנים בסביבה, וכך לבסס Ca אינטר 2 + גל 12,13. Ca 2 + אלה אינטר גלים חשובים לויסות פיזיולוגית נורמלית של שכבות תאים כsyncytium וdysregulation נקשר עם תהליכי pathophysiological 11. באנדותל ואפיתל קרני, קבוצות שונות 14-24, כולל 25-33 משלנו, חקרו את המנגנונים ואת התפקידים של תקשורת בין תאית. בתאים שאינם נרגשים, כמו תאי אנדותל בקרנית, שני מצבים שונים של תקשורת בין תאית להתרחש 28,29, כלומר פער תקשורת בין תאית junctional ותקשורת בין תאית paracrine. תקשורת בין תאית junctional פער כרוכה בחילופים ישירים של מולקולות איתות דרך צמתים פער 7. פער juncתקשורת בין תאית tional היא קריטית לשמירה על הומאוסטזיס רקמות, השליטה התפשטות תאים, והקמה מסונכרנת תגובה ללחץ תאי 10,34,35. במספר פתולוגיות, צימוד צומת פער מצטמצם עקב פגום CXS, ומשפיע על פער תקשורת בין תאית 36 junctional בזאת. זה מדגיש את החשיבות והשפעה של תקשורת בין תאית junctional פער באורגניזמים תאיים. בניגוד לתקשורת בין תאית junctional פער, תקשורת בין תאית paracrine אינה תלויה בפרד תאי תאים, שכן היא כוללת את שחרורו של שליחים תאיים diffusible (איור 2). סוגים שונים של מולקולות איתות משתחררים בחלל החוץ התאי על ידי תאי איתות. המולקולה לאחר מכן הועברה לתא היעד שבו הוא זוהה על ידי חלבון קולטן ספציפי. כתוצאה מכך מורכבת קולט האותות גורם לתגובה תאית, אשרהוא הופסק על ידי הסרת האות, איון או הפחתת רגישות. שליחים תאיים lipophilic פורסם איתות לחדור את הקרום ולפעול על קולטני תאיות. בניגוד לכך, שליחים הידרופילי לא לחצות את קרום הפלזמה של התא להגיב, אבל לפעול כיגנד שנקשר לחלבוני פני שטח, הביעו הקולטן, אשר לאחר מכן להעביר את האות לסביבה תאית. שלוש משפחות עיקריות של חלבונים פני תא קולטן להשתתף בתהליך הזה: קשור יון ערוצים, אנזים צמוד וצמוד לחלבון G. מולקולת השליח שוחרר יכולה לפעול על הקולטנים של אותו התא (autocrine), על תאי המטרה בסמיכות (paracrine), או על תאי היעד רחוקים שדורשים מערכת הדם (האנדוקרינית).

בסוגי תאים רבים, כולל קרנית האנדותל 28,29, ה-ATP הוא אחד הגורמים העיקריים paracrine הידרופילי, המניעים את ההתפשטות של אינטר Ca 2 + גלים 37-40. משךעיוות מכאנית ing, היפוקסיה, דלקת או גירוי על ידי סוכנים שונים, ניתן לשחרר ATP מהתאים בריאים 41-44 בתגובה למאמץ גזירה, מתיחה, או נפיחות האוסמוטי 44,45. מנגנוני ה-ATP-הפצה אחרות כבר הניחו, כולל exocytosis לפוחי 44 ושפע של מנגנוני הובלה, כגון ה-ATP מחייבים קלטות (ABC) מובילים, ערוצי אניון מתח התלויים plasmalemmal 46, P2X7 ערוצי קולט 47,48, כמו גם connexin hemichannels 49-52 וpannexin hemichannels 43,49,53. ATP תאי יכול להיות במהירות הידרוליזה לADP, AMP ואדנוזין 54,55 ידי ectonucleotidases שנמצאים בסביבה תאית. ה-ATP שפורסם extracellularly וADP המטבוליט שלה 56 תהיה להפיץ באמצעות דיפוזיה. האינטראקציה הבאה של נוקלאוטידים אלה עם קולטני purinergic בתאים השכנים הייתה מעורבת בעמ 'ropagation של אינטר Ca 2 + גלים 28,37,51. שני סוגים של קולטנים שונים purinergic נוכחים: אדנוזין הוא ליגנד הטבעי העיקרי לP1-purinoceptors, בעוד הן פורין (ATP, ADP) ופירימידין (UTP, UDP) נוקלאוטידים ביותר לפעול על P2-purinoceptors 57.

תקשורת בין תאית יכולה להיחקר על ידי שיטות שונות כגון טעינה לגרד, העברת צבע, משחררות רפרוף מקומית של אגוניסטים כמו IP 3 וCa 2 +, גירוי מכאני, וכו '. כאן אנו מתארים את המחקר של Ca 2 + התפשטות גל שהושרו על ידי גירוי מכאני של תא בודד. היתרון של לימוד 2 + התפשטות גל CA על ידי גירוי מכאני הוא שהיא מספקת כלי קל לכמת את התפשטות Ca 2 + גל לאורך זמן, והיא מאפשרת השוואת כמותית pretreatments של התאים שונים. באנדותל בקרנית, אלה Ca 2 + אינטר גלים לאפשר שיתוףתגובה מתואמת מmonolayer, מתנהגת בזאת כמנגנון הגנה אפשרי של האנדותל של הקרנית שאינם משובי עוזרים האנדותל לעמוד לחצים תאיים במהלך ניתוח תוך עיני, או בחשיפה למתווכים דלקתיים במהלך דחייה של מערכת חיסון או אובאיטיס 58,59.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. בידוד של תאי אנדותל הקרניים

לפני שיתחיל: לבודד את התאים מהעיניים טריות, המתקבלות מהמטבחיים מקומי, בהקדם האפשרי לאחר enucleating העין. ודא כי העין הייתה enucleated מפרה של בן 18 חודשים, חמש פוסט המורט והשתמרו בתמיסת מלח מאוזנת של ארל דקות מקסימליים - תמיסת יוד 1% ב 4 ° C להובלה למעבדה.

  1. קח עין מתמיסת מלח מאוזנת של ארל - תמיסת יוד 1% ולמקם אותו בצלחת פטרי (100 מ"מ X 20).
  2. לעקר את העין עם תמיסה המכילה 70% אתנול ולשטוף עם תמיסת מלח מאוזנת של ארל המכילה 1% יוד.
  3. משלב זה ואילך, לעבוד במנדף סטרילי. בזהירות לנתח את הקרנית מהעין ולמקם אותו בצלחת פטרי (35 x 10 מ"מ) המכילה תמיסת מלח מאוזנת של ארל, עם שכבת תאי האפיתל פונה כלפי מעלה. להסיר כל Sti רקמת איריס שנותר בזהירותיהיה מחובר לקרנית במידת צורך.
  4. העבר את הקרנית לתמיסת מלח מאוזנת של ארל אחר המכילה צלחת פטרי עם שכבת תאי האנדותל כלפי מעלה ולשטוף פעמיים עם תמיסת מלח מאוזנת של ארל.
  5. העבר את הקרנית עם שכבת האנדותל פונה כלפי מעלה לשעון חול, שהוא מאכל בצורת כוס, ולכסות אותו עם מדיום גידול. מדיום הגידול מורכב מבינוני השתנה Dulbecco של הנשר המכיל גלוקוז 25 מ"מ, 10% בסרום שור עוברי, 6.6% L-גלוטמין, 2.5 מיקרוגרם / מיליליטר amphotericin-B ו 1% תערובת האנטיביוטיקה antimycotic המכיל 10,000 יחידות / מ"ל ​​של פניצילין, 10,000 מיקרוגרם / מ"ל ​​של סטרפטומיצין, ו -25 מיקרוגרם / מיליליטר amphotericin B.
  6. הסר את המדיום עם טפטפת יניקה.
  7. החל μl 300 של פתרון טריפסין (0.5 גר '/ ל') לשכבת האנדותל של הקרנית (כל הצעדים הכוללים טריפסין נעשים באמצעות אותו הריכוז).
  8. הנח את שעון חול המכיל את הקרנית בצלחת פטרי מכוסה ושם אותו בincubator למשך 30 דקות בשעה 37 ° C ו 5% CO 2.
  9. בעדינות לגרד את תאי האנדותל מקרנית עם זכוכית פיפטה פסטר בצורת וו אש מלוטשת בשכונת סטרילי.
  10. תמצוץ את התמיסה המכילה את תאי האנדותל ולהוסיף אותו לתרבות צלוחיות (25 ס"מ 2) המכילות 4 מ"ל של מדיום התרבות.
  11. החל μl 300 של מדיום גידול לקרנית וחזור גירוד ולהוסיף תמיסה המכילה את תאי האנדותל לבקבוק התרבות.
  12. חזור על שלב זה סופי (1.11) פעם נוספת.
  13. הנח את תרבות צלוחיות המכילים את תאי האנדותל בקרנית במדיום הגידול בחממה ב 37 ° C ו 5% CO 2.
  14. לאחר יומיים, להוסיף 6 מ"ל של מדיום התרבות.
  15. רענן מדיום גידול כל יום שני.

2. תרבית תאים

  1. הסר את מדיום התרבות לשטוף את התאים פעמיים עם הפתרון של ארל מאוזן מלח, כאשר confluency הוא הגיע (באבו10 ימים לאחר בידוד t).
  2. הוסף פתרון 1.5 מ"ל טריפסין לתאים כדי לנתק אותם ומניחים את הבקבוק בחממה (37 מעלות צלזיוס, 5% CO 2) במשך 3 עד 4 דקות.
  3. הוסף 12 מ"ל של מדיום גידול. פיפטה שלוש הפעמים בינוניות פנימה והחוצה כדי לפזר את התאים ולספור את התאים.
  4. תאי זרע עם חלק קטן משתנה בהתאם לצפיפות התא ולשים אותם בחממה. הכן שתי שקופיות היטב בליעה (בשטח של 4.2 ס"מ 2) עם ספירת תאים של 165,000 תאים (תא לצפיפות 39,286 2 ס"מ). הכן 80 ס"מ 2 צלוחיות תרבות למעבר חדש בצפיפות של 6,250 ל2 ס"מ, ולהוסיף מדיום התרבות טרי עד נפח כולל של 25 מ"ל.
  5. רענן בינונית כל יומיים.
  6. Confluency של שכבת התאים הוא הגיע לאחר 3 עד 4 ימים. להשתמש בתאים לניסויים.
  7. כאשר confluency של שכבת התאים בצלוחיות הוא הגיע, חזור על שלבי 2.1-2.6. ניתן להשתמש בתרביות תאים עד חלוף 2 Fאו ניסויים.

3. גירוי מכאני לגל סיד התרמה

  1. לטעון את התאים בשקופית הקבורים עם 10 מיקרומטר Fluo-4 בבוקר בפוספט שנאגרו מלוח למשך 30 דקות ב 37 מעלות צלזיוס בזמן הטלטול בעדינות.
  2. הסר Fluo-04:00 פתרון, לשטוף את התאים חמש פעמים עם פוספט שנאגרו מלוח, דגירה התאים עם פוספט שנאגרו מלוח ולהשאיר את התאים לפחות 5 דקות בטמפרטורת חדר לפני המדידה.
  3. אקסייט ב 488 ננומטר עם ארגון לייזר ושימוש קורה המפצל HFT 488, לאסוף את פליטת הקרינה ב530 ננומטר באמצעות longpass פליטת מסנן LP 505, קבע את חריר במינימום. השתמש אובייקטיבי 40X טבילת שמן (אוויר, 1.2 NA). בניסויים עם ARL-67156, השתמש אובייקטיבי 10X (אוויר, 0.3 NA).
  4. לחפש תחום שבו התאים ומחוברות במיקרוסקופ confocal.
  5. עמדת פיפטה כך שזה ב 45 מעלות ביחס לשקופית הבליעה ונוגע בקרום התא.לעורר גירוי מכאני קצר (≈ 1 שניות) לתא בודד. הגירוי מכאני מורכב מעיוות חריפה, קצר טווח של התא על ידי נגיעה פחות מ -1% של קרום התא בקצרה עם micropipette כוס (קוטר קצה <1 מיקרומטר) מצמידים את nanopositioner גביש פיזואלקטריים, המופעל באמצעות מגבר שהוא רכוב על מיקרו מניפולטור. את micropipettes עשוי הזכוכית עם חולץ microelectrode. ודא כי nanopositioner מופעל על ידי מתח בין 0.2 ו 1.5 V במהלך הגירוי מכאני. מתח גבוה מ -1.5 וולט יכול לגרום לניזק לתאים. לכל סוג תא ולמצבו, המתח האופטימלי לגירוי מכאני ללא נזק לתאים צריך להיקבע בזהירות על ידי יישום שורה של מתחים החל מ נמוך (0.2 וולט) למתח גבוה (1.5 וולט). המתח הוא מדד לעוצמת הגירוי שכן מתח זה קובע את הלחץ מכאני ומתח שמוחלים על קרום התא.כוח של הגירוי מכאני יכול להיות מחושב על ידי הכפלת הלחץ מכאני עם האזור. מאז הן האזור (<3.14 מיקרומטר 2) ולחץ מכאני הם נמוכים מאוד, כוח של הגירוי מכאני הוא נמוך. (שים לב שכאשר תא פגום, דליפות הקרינה אל מחוץ לתא והתא הופכים כהות.)
  6. למדוד שינויים מרחביים ב[ Ca 2 +] אני בעקבות גירוי מכאני עם מיקרוסקופ confocal.
  7. לאסוף ולאחסן את תמונות.
  8. צייר אזור polygonal עניין להגדיר את שטח הפנים הכולל של תאים מגיבים (האזור פעיל, א.א.) באמצעות התוכנה של מיקרוסקופ confocal.

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

כל הניסויים מבוצעים בעמידה בכל ההנחיות הרלוונטיות, תקנות וגופים הרגולטוריים ואת הפרוטוקול שמפגינים מבוצע תחת הדרכתו ואישורו של הטיפול בבעלי החיים ועדת שימוש בלובן KU.

בתאי אנדותל בקרנית שור (BCEC), צמתים פער תפקודיים באים לידי ביטוי וגם תקשורת בין תאית junctional פער ותקשורת בין תאית paracrine לתרום באופן משמעותי לתקשורת בין תאית באופן אינטראקטיבית, אבל המסלול העיקרי הוכח להיות מסלול תקשורת בין תאית paracrine מתווך על ידי שחרור ATP דרך hemichannels מבוסס Cx43 28,29. ה-ATP ADP, והם עברו הידרוליזה לאדנוזין monophosphate (AMP) על ידי ectonucleotidase דואר NTPD1 (ectonucleoside אדנוזין 1 diphosphohydrolase, CD39-ATP diphosphohydrolase), ולאחר מכן לאדנוזין ידי 5'-CD73 ectonucleotidase 28,29. ה-ATP ADP ולתרום2 התפשטות הגל + CA על ידי קשירה לקולטנים P2Y1 וP2Y2 28,29. שני בני זוג קולטנים למועצה מחוקקת הפלסטינית באמצעות GQ ובכך לעורר IP 3-Induced Ca 2 + שחרור (איור 2). בBCEC, הגירוי של התוצאות קולטנים P2Y purinergic בגידול מהיר ב[ Ca 2 +] אני, שאינו רגיש להסרת [Ca 2 +] o 60. [Ca 2 +] אני פסגות עוררו על ידי גירוי אגוניסט ואחריו [Ca 2 +] אני ירידה אשר יכול להוביל להעלאת רמה יציבה, אגוניסט תלויה, [Ca 2 +] תנודות oscillatory o תלויות, או חזרה לנקודת ההתחלה 60-62. בBCEC, יש כבר ראיות לכך שCa 2 + שחרור מתרחש באמצעות מסלול מעורב PLC ו-IP 3 29. ריקון מחנויות 3 רגישות IP מוביל לשיא ראשוני ב[ Ca 2 +] אני, ואחריו לאחר מכן על ידי CApacitative Ca 2 + זרם שהוביל לתחילתו של שלב הרמה 63.

גירוי מכאני גורם לעלייה ראשונית מהירה בCa 2 + שמקורו מנקודת הגירוי ולאחר מכן מתפשט בכל תא מגורה באופן מכאני. לבסוף, תאיים Ca 2 +-רמות לצמצם חזרה לאט לרמה הבסיסית. עם הגיע לגבולות התא, את 2 + מתפשט גל אינטר Ca לתאים המקיפים שכנות (NB) בצורה גלית כמו Ca 2 + ארעי, שדועך לרמה בסיסית (איור 3). בתנאי בקרה, Ca 2 + ארעיים נצפו עד כ 4 עד 8 ​​שכבות תאים מן תא מגורה מכאני (איור 3). גרף הקו (בצד של הפנלים באיור 3 מימין) מציג את מהלך הזמן של Ca 2 + ארעיים (מיוצג כמנורמלים הקרינה (NF) ערכים) בתא מגורה מכאני ובשכבות התאים השכנות 4:59 (NB1, NB2, NB3, NB4 וNB5). מאיור 3, ברור כי ירידות הקרינה המנורמלות, תוך עיכוב הזמן לתחילתה של [Ca 2 +] עליות i-לעלות עם הגדלת מרחק מתא מגורה באופן מכאני. הקרינה המנורמלת המקסימלי בתא מגורה מכאני הושגה ב0.95 ± 0.04 שניות. לאחר שהגיע לערך מקסימאלי מנורמל הקרינה, הקרינה המנורמלת הראתה ירידה מאוד הדרגתית ואיטית, חוזרת לערך הבסיסי 152 ± 6 שניות לאחר היישום של הגירוי 25.

העיכוב של מסלול התקשורת בין תאית paracrine באמצעות שילוב של אקסוגני apyrase VI (5 U / מ"ל למשך 30 דקות) וapyrase שביעי (5 U / מ"ל למשך 30 דקות) גרם לירידה של פי 7.5 בתחום המכוסה על ידי Ca 2 + גל, מה שנקרא באזור הפעיל (AA, P <0.001, n = 7, N = 35) (איור 4 א). Apyrase ידוע hydrolyze ה-ATP וADP. יש Apyrase השישי יחס ATPase / ADPase גבוה וapyrase שביעי מעדיף hydrolyzes ADP 56.

מאז תקשורת בין תאית paracrine באנדותל של הקרנית במידה רבה מתרחשת באמצעות שחרור ATP, 28,29 וה-ATP היא הידרוליזה בחלל החוץ התאי על ידי ectonucleotidases, הידועים להתבטא באנדותל בקרנית, 29,64,65 שחקרנו את ההשפעה על AA בתנאים בי הידרוליזה ה-ATP עכבות באמצעות מעכבי ectonucleotidase. עיכוב של ectonucleotidases עם ARL-67156 (ARL; 100 מיקרומטר למשך 30 דקות) הביא לשיפור חזק של התפשטות גל + Ca 2, כפי שכבר הוכיח בעבר בBCEC 25,26,28,29. החשיפה של BCEC לARL גרמה לעלייה של פי 3.5 בהשוואה לAA לשלוט בתנאים (P <0.001, n = 12, N = 60) (איור 4).

במראשמחקרי ף במעבדה שלנו, פפטידים כוזבים connexin (Gap26 וGap27, טבלת 2) היו בשימוש כדי להבדיל את התרומה היחסית של תקשורת בין תאית junctional פער ותקשורת בין תאית paracrine לאינטר Ca 2 + התפשטות גל בעקבות גירוי מכאני, עם פפטיד לא פעיל ( טבלת 2) כביקורת 28,29.

עיכוב של ערוצי צומת פער עם Gap27 ירד ההתפשטות של Ca 2 + גל בBCEC 30 באופן משמעותי. א.א. הופחת באופן משמעותי על טיפול מקדים עם Gap27 (300 מיקרומטר למשך 30 דקות) (P <0.001, n = 8, n = 40) 25 (טבלת 1). עיכוב של hemichannels connexin עם פפטיד Gap26 28,30 connexin-כוזב קטינה באופן משמעותי את ההתפשטות של Ca 2 + גל בBCEC 28. א.א. הופחת באופן משמעותי על טיפול מקדים עם Gap26 (300 מיקרומטר למשך 30 דקות)(P <0.001, n = 8, n = 40) 25 (טבלת 1).

אנחנו גם הראו כי 43-kDa Cx איזופורם היה מרכיב עיקרי שביסוד שחרור ATP hemichannel בתיווך שמעורר אינטר Ca 2 + גלים. שימוש בשתי מולקולות siRNA באופן עצמאי נועדו מיקוד Cx43, מצאנו כי AA הופחת בשיעור של כ 65% 33 (טבלת 1). זה היה עוד יותר להתבסס על ניסויים באמצעות TAT-L2 (100 מיקרומטר, 30 דקות), פפטיד תא חדיר מקביל למחצית השנייה של הלולאה תאית של Cx43 (טבלה 2), שעוררה הפחתה משמעותית בAA (P <0.001 , N = 3, n = 30) (טבלת 1). חשוב מכך, ירידה זו בAA על ידי הדגירה TAT-L2 לא הבחינה בהעדר איתות paracrine, תמיכה ברעיון שTAT-L2 סלקטיבי מעכב hemichannels מבוסס Cx43 אך לא ערוצי צומת פער 33. יתר על כן, לא פעיל TAT-L2 מוטציה (TAT-L2-H126K/I130N) יכול לשמש כביקורת (טבלה 2).

איור 1
איור 1. היווצרות של ערוצי צומת גאפ וhemichannels: ייצוג סכמטי. א hemichannel connexin או pannexin נוצר כאשר שש connexins או pannexins, שהם חלבונים המכילים ארבעה הטרנסממברני-תחום, מסודרים רדיאלית סביב נקבובית מרכזי. Hemichannels ממוקמים בקרום התא. הם יכולים להיות מורכבים של תת חלבון זהה (hemichannels homomeric) או שהם יכולים להיות מורכבים של תת חלבון שונה, כאשר שתיים או יותר isoforms באים לידי ביטוי באותו התא (hemichannels heteromeric). ערוץ צומת פער homotypic נובע מהעגינה של שתי homomeric הזהה או hemichannels heteromeric. תוצאות ערוץ צומת פער heterotypic מ דocking של שני ערוצי homomeric או heteromeric שונים. מבנה סכמטי ב 'של connexin וערוצי צומת פער pannexin חיבור שני תאים וhemichannels סמוכים.

(שונה חלקית מ66)

נתון זה פורסם במקור בBioEssays. Catheleyne ד 'hondt, Ponsaerts הרף, הומברט דה Smedt, גירט Bultynck, וברנרד Himpens. Pannexins, קרובים רחוק של משפחת connexin עם פונקציות תאיות ספציפיות. BioEssays. 2009, 31, 953-974 (2009). BioEssays. לחץ כאן לצפייה בדמות גדולה.

איור 2
איור 2. בתאים שאינם נרגשים, ב2 התפשטות tercellular + גל Ca כרוך הן בתקשורת בין תאית junctional פער ותקשורת בין תאית paracrine. על הגירוי מכאני של תא בודד, Ca 2 + עלייה מתרחשת בתא מגורה מכאני (MS) באמצעות Ca 2 + זרם ו / או Ca 2 + שחרור. לאחר מכן, 2 קומות + מתפשט Ca ממכאני מגורה לתאים השכנים (NB) כמו גל + Ca 2 אינטר. הריבוי אינטר כולל שני מנגנונים, תקשורת בין תאית junctional כלומר פער ותקשורת בין תאית paracrine. בתקשורת בין תאית junctional פער, חילופי ישירים של מתווך (IP 3 ו / או Ca 2 +) מתרחש בין cytoplasms של תאים סמוכים באמצעות צמתים פער (GJS). בתקשורת בין תאית paracrine, שליח (לדוגמא ה-ATP) משתחרר לתוך חלל החוץ התאי, ובכך פועל על קולטנים הנמצאים על הפני השטח של תאי דואר סמוכים. Hemichannels (HCS) או מנגנונים אחרים לתווך שחרור ATP זה (ראה טקסט). Ectonucleotidases Hydrolyze ATP ולADP AMP. ה-ATP ADP ומעשה בP2Y ו / או קולטנים P2X על תאים שכנים. (צילום מ -66).

נתון זה פורסם במקור בBioEssays. Catheleyne ד 'hondt, Ponsaerts הרף, הומברט דה Smedt, גירט Bultynck, וברנרד Himpens. Pannexins, קרובי משפחה רחוקים של משפחת connexin עם פונקציות תאיות ספציפיות. BioEssays. 2009., 31 953-974 (2009). BioEssays.

איור 3
איור 3. התפשטות גל סיד בתנאי בקרה בBCEC. ארעיים גירוי מכאניים המושרה סידן מוצגת בנקודתי זמן שונה בתנאי בקרה בBCEC ידי תמונות הקרינה פסאודו צבעוניות מייצגות. Fluoreעוצמות scence לפני הגירוי מוצגות בתמונה הראשונה. החץ הלבן בתמונה השנייה מזהה את תא מגורה באופן מכאני. גל סידן מתפשט לשש שכבות תאים שכנות בשטח כולל של תאים שהושגו על ידי הגל (אזור פעיל: AA) של 62,870 מיקרומטר 2.

הפנל הימני עם הגרפים הקו מראה את מהלך הזמן של הערך המנורמל הקרינה (NF) בתא מגורה מכאני (MS) ואת הערך הממוצע של NF בתאים השכנים (NB) שכבות 1 עד 5 (NB1 לNB5). (שונה חלקית מ25.)

נתון זה פורסם במקור ברפואת עיניים חקירתית ומדע חזותי. Catheleyne ד 'hondt, רף Ponsaerts, Sangly P Srinivas, יוהאן Vereecke, וברנרד Himpens. תרומבין מעכב התפשטות גל סידן בין תאית בתאי אנדותל בקרנית על ידי אפנון של hemichannels וצמתים פער. להשקיע. Ophthalmol. מול. Sci. 2007. עיניים חקירתית ומדע חזותי.

איור 4
איור 4. שינויים משמעותיים בהתפשטות אינטר Ca 2 + לאחר טיפול בגלים nucleotidases אקסוגניים (משמאל) ועם מעכבי ectonucleotidase (מימין) בBCEC. ירידה משמעותית בא.א. א לאחר טיפול של BCEC עם apyrases אקסוגניים (apyrase VI (5 U / ml) וapyrase שביעי (5 U / ml) למשך 30 דקות) אשר Hydrolyze ה-ATP וADP, מסלול התקשורת בין תאית paracrine בזאת עיכוב (N = 7, n = 35). * מסמל P <0.001 בנוכחות לעומת העדר apyrase עלייה משמעותית ב-AA באחרי טיפול של BCEC עם מעכב סלקטיבי ectonucleotidase ARL-67156 (ARL; 100 מיקרומטר למשך 30 דקות)., Herby enhancinG מסלול תקשורת בין תאית paracrine (N = 12, N = 60). * מסמל P <0.001 בנוכחות לעומת העדר ARL.

א.א. המנורמל סנט שגיאה N n סטטיסטיקה
לשלוט 100 8.31 3 30
siScramble 87.97 9.3 3 30
siCx43-1 32.45 8.23 3 30 *
siCx43-2 35.49 7.06 3 30 *
שליטת פפטיד 91.68 6.5 8 40
פער 26 46.67 4.24 8 40 *
פער 27 53 4.76 8 40 *
TAT-L2 6.99 0.71 3 30 *

טבלת מס '1. השפעה של מולקולות siRNA מיקוד Cx43, פפטידים כוזבים connexin ופפטיד תא החדיר TAT-L2 באזור הפעיל המנורמל (AA) בBCEC.
N מייצג את מספר הימים של ניסויים, n מייצג את מספר הגירויים מכאניים. * מסמל P <0.001 בהשוואה לתנאי ביקורת.

<TR>
רצף AA
שליטת פפטיד SRGGEKNVFIV
Gap26 VCYDKSFPISHVR
Gap27 SRPTEKTIFII
TAT-L2 YGRKKRRQRRR-DGANVDMHLKQIEIKKFKYGIEEHGK
TAT-L2H126K/I130N YGRKKRRQRRR-DGANVDMKLKQNEIKKFKYGIEEHGK
10Panx1 WRQAAFVDSY

טבלת 2. רצפי חומצות האמיניות של פפטידים המשמשים.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

בכתב יד זה, אנו מתארים שיטה פשוטה למדידת 2 + אינטר התפשטות גל CA בmonolayers של תאי האנדותל בקרנית שור ראשוניים על ידי מתן גירוי מכאני מקומית ומבוקר באמצעות micropipette. תאי מגורה מכאני מגיבים בעלייה מקומית בIP תאי 3 וCa 2 +, אשר שניהם הם מולקולות איתות תאיות חיוניות המניעות אינטר Ca 2 + גל התפשטות 11,67. ה-IP של 3 מועבר ישירות לתאי שכנים באמצעות ערוצי צומת פער 5, בעוד Ca 2 + מעורר פתיחת hemichannels ושחרורו של 68,69-ATP, אשר מפעיל Ca 2 + אותות בתאי שכנים באמצעות ההפעלה של P2 מצמידים G-חלבון קולטנים 37-40. התרומה היחסית של ערוצי צומת גאפ וhemichannels בתהליך זה יכול להיות מאופיינת על ידי השימוש בCx-כוזבפפטידים, אנזימים ATP-משפילים (ectonucleotidases) ומעכבות ectonucleotisdases. את המאפיינים של 2 התפשטות מכאנית מושרה גירוי אינטר Ca + גל בתאי אנדותל בקרנית שור התאפיינו ביסודיות במעבדה שלנו 25-33. התוצאות שלנו מצביעות על כך שאינטר + 2 התפשטות גל CA היא מונעת בעיקר על ידי שחרורו Cx-hemichannel בתיווך של ה-ATP, עם Cx43 משחק תפקיד מרכזי. ככזה, שיטה זו מיושמת על תאי האנדותל בקרנית שור עיקריים מתאימה במיוחד כדי לזהות או לאפיין את הרגולציה של Cx43 hemichannels ברמות אנדוגני בתאים מקומיים. באמצעות שיטה זו, מצאנו כי פעילותו של Cx43 hemichannels נשלטת באופן ביקורתי על ידי שלד תא actomyosin, אשר עשוי לשמש כבלמי אנדוגני מניעה מוגזמים, ובכך המזיק, Cx43 פתיחת hemichannel 25,31,32. בנוסף, אנו להבהיר את המנגנונים המולקולריים שבבסיס הוראה זו ותמצאותפקיד חשוב של אינטראקציות לולאה / זנב intramolecular כי הם חיוניים לפתיחת Cx43 hemichannels 33.

ברור שהמערכת הזאת מתאימה מאוד ללימוד הפונקציה של ערוצי צומת פער CX ומבוסס Panx וhemichannels, והוא בהחלט אינו מוגבל לתאי אנדותל קרנית שור אלא להתאמה כמעט לכל סוג תא וגם רקמות מורכבות יותר, כפי שהוכחה במוח שבו גירוי מכאני מופעל אינטר Ca הגדול 2 + גלים המקיפים את כל חצי הכדור 70. כלים שונים נוכחים כדי להעריך את התרומה של ערוצי פער צומת וhemichannels, כוללים פפטידים Cx-כוזבים, אנזימי ATP-משפילים, מעכבים של ectonucleotidases ותרכובות תרופתיות כמו carbenoxolone ו10 Panx1 (טבלה 2) 49,50. כדי לקבוע את תרומתו של Cx מסוים או Panx איזופורם בתהליך זה, בדיקות siRNA תוכננו בקפידה לאargeting שני אזורים עצמאיים של ה-mRNA ושליטה מקושקשת צריך להיות בשימוש. היקף מציאה צריך להיקבע ברמת החלבון הכוללת באמצעות מבחני סופגים מערבי ורמת התא הבודד באמצעות מיקרוסקופ פלואורסצנטי. יעילות transfection של בדיקות siRNA בmonolayers הסלולרי הניסיוניות צריכה להיות מוערכת על ידי מיקרוסקופ פלואורסצנטי. לשם כך, אפשר לפתח siRNA דופלקס שבתווית ניאון כבר שולב בסופו של הדבר 3 'של הגדיל הגיוני. חשוב לציין כי לניתוח נכון, ירידה בולטת של CX או Panx איזופורם (> 90% ירידה), כמו גם transfection הומוגנית של siRNA דופלקסים בשכבת התא (> 90% של התאים transfected עם siRNA יש לקבל את הבדיקה). סלקטיביות של בדיקות siRNA נועדו לעבר המטרה צריכה להיות מוערכת 71. בקיצור, צריכים להיות מאומתים בכלים אלה, כך שהם אינם משפיעים על הביטוי של Cx האחר או isoforms Panx או com מפתח האחרponents נהיגה אינטר Ca 2 + גלים, כמו קולטנים P2X או P2Y. כדי להעריך את תרומתו של Cx43 hemichannels, יש לנו שיתוף פעולה עם מעבדתו של ד"ר Leybaert בפיתוח פפטיד תא חדיר מקביל למחצית השנייה של הלולאה תאית של Cx43 (TAT-L2) שפועלת כמעכב סלקטיבי, עוצמה של Cx43 hemichannels תוך שמירה על פעילות ערוץ צומת Cx43 פער 33. במחקרים שלנו, אנו משתמשים בTAT-L2 100 מיקרומטר להשיג עיכוב של Cx43 hemichannels מלא, אבל ריכוזים נמוכים עשויים להיות 72 מספיקים. TAT-L2H126K/I130N מומלץ כביקורת שלילית 73. כדי להעריך את תרומתו של Panx1 ערוצים, ניתן ליישם את הפפטיד 10Panx1. כלים אלה הם חשובים לא רק לנטרול שיבוש קרום פלזמה (ראה להלן), אלא גם להוכחה כי מתווך paracrine ATP איתות המנגנונים של 2 התפשטות אינטר + גל CA על ידי ולא על ידי hemichannels מנגנונים אחרים (כמו מ 'ערוצי AXI-אניון או השחרור של שלפוחית ​​המכילה ATP). לבסוף, כמו בכל המחקרים באמצעות תאים ראשוניים, בתנאי תרבית התאים ובמספר הקטעים חייבים להיות אחידים, כמו את המאפיינים הביולוגיים של התאים ובכך את פרופיל הביטוי של CX שונה וisoforms Panx עשוי להשתנות עם הזמן 26.

עם זאת, יש מספר החסרונות לשיטה זו. חסרון עיקרי בשיטה הוא שגירוי מכאני עלול לעורר שיבוש קרום פלזמה, מה שמוביל לכניסתם של תאי Ca 2 + ואת שחרורו של מולקולות איתות כמו ה-ATP, אשר שניהם ביסוד תום Ca 2 + התפשטות גל אינטר בתום 11. זה בהחלט מסבך את הניתוח (כמותי) של Ca אינטר 2 + גל. לכן, זה מאוד מומלץ כי יש לי) להשתמש בבקרות נאותות, קווים סלולריים כלומר אשר חוסר הביטוי של Cx או isoforms Panx, וכלים שInterfere עם הפונקציה של Cx וPanx כערוצי פער צומת ו / או hemichannels ו-II) סטנדרטיזציה של הליך הגירוי מכאני (לוודא שבזמן הגירוי מכאני nanopositioner מופעל על ידי מתח בין 0.5 ו 2 V).

יתר על כן, חשוב לציין כי שיטה זו אינה עומדת בפני עצמו, אבל צריך להתבסס על גישות ניסיוניות נוספים ללמוד ערוצי CX וPanx. זו יכולה להיות מושגת על ידי שימוש בגידול מקומי של מולקולות איתות תאיות המשתתפות בריבוי 2 Ca בין תאית מכאני, גירוי בתיווך + גל, כמו משחררות הרפרוף של ה-IP תאי 3 או Ca 2 + 11,74. ליזום אינטר Ca 2 + גל עצמאי של גירוי מכאני, אפשר להשתמש במייקרו הזרקה, כגון Bax רקומביננטי הפרו אפופטוטיים 11,75 וצילום activatable Ca 2 + מאגרים כמו diazo-2 שגורם לירידה מקומית בתאי [Ca 2 + 76, הדק ידוע בפתיחת hemichannel. לחלופין, אפשר להשתמש ב electroporation באתרו של מולקולות איתות תא בלתי חדירות שיפעילו תאיים Ca 2 + שחרור ואינטר Ca 2 + גלים, כגון ה-IP של 3 67,68. הטכניקה האחרונה משמשת גם כדי לחקור את הפצה של מוות של תאי 5,77. גירויים שאינם מכאניים אלה מספקים הערכה טובה יותר של עוצמת הגירוי לתגובה. בנוסף ל2 שיטות הריבוי + גל Ca אלה, חשוב לקבוע את פעילותם של ערוצי CX או Panx באמצעות גישות אחרות, לרבות הקביעה של ספיגת צבע הידרופילי (כמו לוציפר צהוב) 78 ואת שחרורו של ה-ATP, לא רק ב תגובה לגירוי מכאני, אלא גם בתגובה לתאי Ca 2 + מאגרים (כמו EGTA) ו -2 מולקולות + לשחרור Ca תאיים (כמו Ca 2 + ionophore A23187) 11,74. בנוסף, לאהוא ההוכחה הטובה ביותר להסדרה ברמת הערוץ מסופק על ידי ניסויים, מערכות אלקטרו מהדק מתח כפולות או או מהדק נתיב כל התא של ביציות Xenopus הזריקו Cx או Panx mRNA או של תאי הלה ectopically להביע isoforms CX יחד עם סמן כמו ה-GFP 79-84.

לסיכום, השימוש בגירוי מכאני לגרימה אינטר Ca 2 + גלים מספק שיטה פשוטה ואמינה כדי לחקור תקשורת תאית ולבחון את תרומתו ואת המאפיינים של ערוצי CX וPanx.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

יש מחברים אין לחשוף.

Acknowledgments

עבודת מחקר שבוצעה במעבדה נתמכה על ידי מענקי קרן המחקר - פלנדריה (FWO; מספרי מענק G.0545.08 וG.0298.11), תכנית הפולנים המשיכה הבינאוניברסיטאי (מדיניות מדע בלגית; מענק מספר P6/28 וP7/13) ומוטבע בקהילת מחקר FWO נתמכת. CDH הוא פוסט דוקטורט של קרן המחקר - פלנדריה (FWO). המחברים מודים מאוד לכל חברי ההווה ובעבר של המעבדה של איתות מולקולרית ותאית (KU לובן), ד"ר SP Srinivas (אוניברסיטת אינדיאנה הספר לאופטומטריה, ארה"ב), המעבדה של ד"ר Leybaert (אוניברסיטת גנט) ושל ד"ר Vinken (Vub) שסיפק דיונים מועילים, מותאם נהלים או היו מעורב בפיתוח כלים לחקר hemichannels connexin.

Materials

Name Company Catalog Number Comments
Earle's Balanced Salt Solution (EBSS) Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 14155-048
Iodine Sigma-Aldrich (Deisenhofen, Germany) 38060-1EA
Dulbecco's Modified Eagle's Medium (DMEM) Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 11960-044
L-glutamine (Glutamax) Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 35050-038
Amphotericin-B Sigma-Aldrich (Deisenhofen, Germany) A2942
Antibiotic-antimycotic mixture Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 15240-096
Trypsin Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 25300-054
Dulbecco's PBS Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) 14190-091
Fluo-4 AM Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) F14217
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) Sigma-Aldrich (Deisenhofen, Germany) A265
Apyrase VI Sigma-Aldrich (Deisenhofen, Germany) A6410
Apyrase VII Sigma-Aldrich (Deisenhofen, Germany) A6535
Gap26 (VCYDKSFPISHVR) Custom peptide synthesis
Gap27 (SRPTEKTIFII) Custom peptide synthesis
Control Peptide (SRGGEKNVFIV) Custom peptide synthesis
siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK) Thermo Electron (Ulm, Germany)
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) Thermo Electron (Ulm, Germany)
Two chambered glass slides Laboratory-Tek Nunc (Roskilde, Denmark) 155380
Confocal microscope Carl Zeiss Meditec (Jena, Germany) LSM510
Piez–lectric crystal nanopositioner (Piezo Flexure NanoPositioner) PI Polytech (Karlsruhe, Germany) P-280
HVPZT-amplifier PI Polytech (Karlsruhe, Germany) E463 HVPZT-amplifier
Glass tubes (glass replacement 3.5 nanoliter) World Precision Instruments, Inc. Sarasota, Florida, USA 4878
Micr–lectrode puller Zeitz Instrumente (Munchen, Germany) WZ DMZ-Universal Puller

DOWNLOAD MATERIALS LIST

References

  1. Vinken, M., et al. Connexins and their channels in cell growth and cell death. Cell Signal. 18, 592-600 (2006).
  2. Mese, G., Richard, G., White, T. W. Gap junctions: basic structure and function. J. Invest. Dermatol. 127, 2516-2524 (2007).
  3. Bruzzone, R., White, T. W., Paul, D. L. Connections with connexins: the molecular basis of direct intercellular signaling. Eur. J. Biochem. 238, 1-27 (1996).
  4. White, T. W., Bruzzone, R., Paul, D. L. The connexin family of intercellular channel forming proteins. Kidney Int. 48, 1148-1157 (1995).
  5. Decrock, E., et al. Connexin-related signaling in cell death: to live or let die? Cell Death Differ. 16, 524-536 (2009).
  6. Herve, J. C. Gap junctional complexes: from partners to functions. Prog. Biophys. Mol. Biol. 94, 1-4 (2007).
  7. Herve, J. C., Bourmeyster, N., Sarrouilhe, D., Duffy, H. S. Gap junctional complexes: from partners to functions. Prog. Biophys. Mol. Biol. 94, 29-65 (2007).
  8. Bruzzone, R., Barbe, M. T., Jakob, N. J., Monyer, H. Pharmacological properties of homomeric and heteromeric pannexin hemichannels expressed in Xenopus oocytes. J. Neurochem. 92, 1033-1043 (2005).
  9. Ebihara, L., Steiner, E. Properties of a nonjunctional current expressed from a rat connexin46 cDNA in Xenopus oocytes. J. Gen. Physiol. 102, 59-74 (1993).
  10. Evans, W. H., De Vuyst, E., Leybaert, L. The gap junction cellular internet: connexin hemichannels enter the signalling limelight. Biochem. J. 397, 1-14 (2006).
  11. Leybaert, L., Sanderson, M. J. Intercellular Ca2+ waves: mechanisms and function. Physiol. Rev. 92, 1359-1392 (2012).
  12. Sanderson, M. J., Charles, A. C., Dirksen, E. R. Mechanical stimulation and intercellular communication increases intracellular Ca2+ in epithelial cells. Cell Regul. 1, 585-596 (1990).
  13. Himpens, B., Stalmans, P., Gomez, P., Malfait, M., Vereecke, J. Intra- and intercellular Ca2+ signaling in retinal pigment epithelial cells during mechanical stimulation. Faseb J. 13, 63-68 (1999).
  14. Williams, K. K., Watsky, M. A. Bicarbonate promotes dye coupling in the epithelium and endothelium of the rabbit cornea. Curr. Eye Res. 28, 109-120 (2004).
  15. Hernandez Galindo, E. E., Theiss, C., Steuhl, K. P., Meller, D. Gap junctional communication in microinjected human limbal and peripheral corneal epithelial cells cultured on intact amniotic membrane. Exp Eye Res. 76, 303-314 (2003).
  16. Williams, K., Watsky, M. Gap junctional communication in the human corneal endothelium and epithelium. Curr. Eye Res. 25, 29-36 (2002).
  17. Anderson, S. C., Stone, C., Tkach, L., SundarRaj, N. Rho and Rho-kinase (ROCK) signaling in adherens and gap junction assembly in corneal epithelium. Invest. Ophthalmol. Vis. Sci. 43, 978-986 (2002).
  18. Joyce, N. C., Harris, D. L., Zieske, J. D. Mitotic inhibition of corneal endothelium in neonatal rats. Invest. Ophthalmol. Vis. Sci. 39, 2572-2583 (1998).
  19. Klepeis, V. E., Weinger, I., Kaczmarek, E., Trinkaus-Randall, V. P2Y receptors play a critical role in epithelial cell communication and migration. J. Cell Biochem. 93, 1115-1133 (2004).
  20. Klepeis, V. E., Cornell-Bell, A., Trinkaus-Randall, V. Growth factors but not gap junctions play a role in injury-induced Ca2+ waves in epithelial cells. J. Cell Sci. 114, 4185-4195 (2001).
  21. Laux-Fenton, W. T., Donaldson, P. J., Kistler, J., Green, C. R. Connexin expression patterns in the rat cornea: molecular evidence for communication compartments. Cornea. 22, 457-464 (2003).
  22. Rae, J. L., Lewno, A. W., Cooper, K., Gates, P. Dye and electrical coupling between cells of the rabbit corneal endothelium. Curr. Eye Res. 8, 859-869 (1989).
  23. Watsky, M. A., Rae, J. L. Dye coupling in the corneal endothelium: effects of ouabain and extracellular calcium removal. Cell Tissue Res. 269, 57-63 (1992).
  24. Williams, K. K., Watsky, M. A. Dye spread through gap junctions in the corneal epithelium of the rabbit. Curr. Eye Res. 16, 445-452 (1997).
  25. D'hondt, C., Ponsaerts, R., Srinivas, S. P., Vereecke, J., Himpens, B. Thrombin inhibits intercellular calcium wave propagation in corneal endothelial cells by modulation of hemichannels and gap junctions. Invest. Ophthalmol. Vis. Sci. 48, 120-133 (2007).
  26. D'hondt, C., Ponsaerts, R., Srinivas, S. P., Vereecke, J., Himpens, B. Reduced intercellular communication and altered morphology of bovine corneal endothelial cells with prolonged time in cell culture. Curr. Eye Res. 34, 454-465 (2009).
  27. D'hondt, C., Srinivas, S. P., Vereecke, J., Himpens, B. Adenosine Opposes Thrombin-Induced Inhibition of Intercellular Calcium Wave in Corneal Endothelial Cells. Invest Ophthalmol. Vis. Sci. 48, 1518-1527 (2007).
  28. Gomes, P., Srinivas, S. P., Van Driessche, W., Vereecke, J., Himpens, B. ATP release through connexin hemichannels in corneal endothelial cells. Invest. Ophthalmol. Vis. Sci. 46, 1208-1218 (2005).
  29. Gomes, P., Srinivas, S. P., Vereecke, J., Himpens, B. ATP-dependent paracrine intercellular communication in cultured bovine corneal endothelial cells. Invest. Ophthalmol. Vis. Sci. 46, 104-113 (2005).
  30. Gomes, P., Srinivas, S. P., Vereecke, J., Himpens, B. Gap junctional intercellular communication in bovine corneal endothelial cells. Exp Eye Res. (2006).
  31. Ponsaerts, R., et al. The myosin II ATPase inhibitor blebbistatin prevents thrombin-induced inhibition of intercellular calcium wave propagation in corneal endothelial cells. Invest. Ophthalmol. Vis. Sci. 49, 4816-4827 (2008).
  32. Ponsaerts, R., et al. RhoA GTPase Switch Controls Cx43-Hemichannel Activity through the Contractile System. PLoS ONE. 7, e42074 (2012).
  33. Ponsaerts, R., et al. Intramolecular loop/tail interactions are essential for connexin 43-hemichannel activity. Faseb J. 24, 4378-4395 (2010).
  34. Charles, A. Reaching out beyond the synapse: glial intercellular waves coordinate metabolism. Sci STKE. 2005, pe6 (2005).
  35. Laird, D. W. Life cycle of connexins in health and disease. Biochem. J. 394, 527-543 (2006).
  36. Kelsell, D. P., Dunlop, J., Hodgins, M. B. Human diseases: clues to cracking the connexin code. Trends Cell Biol. 11, 2-6 (2001).
  37. Pearson, R. A., Dale, N., Llaudet, E., Mobbs, P. ATP released via gap junction hemichannels from the pigment epithelium regulates neural retinal progenitor proliferation. Neuron. 46, 731-744 (2005).
  38. Klepeis, V. E., Weinger, I., Kaczmarek, E., Randall, V. T. P2Y receptors play a critical role in epithelial cell communication and migration. J. Cell Biochem. 93, 1115-1133 (2004).
  39. Cotrina, M. L., Lin, J. H., Lopez-Garcia, J. C., Naus, C. C., Nedergaard, M. ATP-mediated glia signaling. J. Neurosci. 20, 2835-2844 (2000).
  40. Burnstock, G., Williams, M. P2 purinergic receptors: modulation of cell function and therapeutic potential. J. Pharmacol. Exp. Ther. 295, 862-869 (2000).
  41. Schwiebert, E. M., Zsembery, A. Extracellular ATP as a signaling molecule for epithelial cells. Biochim. Biophys Acta. 1615, 7-32 (2003).
  42. Lazarowski, E. R., Boucher, R. C., Harden, T. K. Mechanisms of release of nucleotides and integration of their action as P2X- and P2Y-receptor activating molecules. Mol. Pharmacol. 64, 785-795 (2003).
  43. Dubyak, G. R., el-Moatassim, C. Signal transduction via P2-purinergic receptors for extracellular ATP and other nucleotides. Am. J. Physiol. 265, C577-C606 (1993).
  44. Blair, S. A., Kane, S. V., Clayburgh, D. R., Turner, J. R. Epithelial myosin light chain kinase expression and activity are upregulated in inflammatory bowel disease. Lab. Invest. 86, 191-201 (2006).
  45. Boudreault, F., Grygorczyk, R. Cell swelling-induced ATP release and gadolinium-sensitive channels. Am. J. Physiol. Cell Physiol. 282, C219-C226 (2002).
  46. Romanov, R. A., Rogachevskaja, O. A., Khokhlov, A. A., Kolesnikov, S. S. Voltage dependence of ATP secretion in mammalian taste cells. J. Gen. Physiol. 132, 731-744 (2008).
  47. Pelegrin, P., Surprenant, A. Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor. Embo J. 25, 5071-5082 (2006).
  48. Surprenant, A., Rassendren, F., Kawashima, E., North, R. A., Buell, G. The cytolytic P2Z receptor for extracellular ATP identified as a P2X receptor (P2X7). Science. 272, 735-738 (1996).
  49. D'hondt, C., et al. Pannexin channels in ATP release and beyond: an unexpected rendezvous at the endoplasmic reticulum. Cell Signal. 23, 305-316 (2011).
  50. Leybaert, L., et al. Connexin channels, connexin mimetic peptides and ATP release. Cell Commun. Adhes. 10, 251-257 (2003).
  51. Stout, C. E., Costantin, J. L., Naus, C. C., Charles, A. C. Intercellular calcium signaling in astrocytes via ATP release through connexin hemichannels. J. Biol. Chem. 277, 10482-10488 (2002).
  52. Verma, V., Hallett, M. B., Leybaert, L., Martin, P. E., Howard Evans, W. Perturbing plasma membrane hemichannels attenuates calcium signalling in cardiac cells and HeLa cells expressing connexins. Eur. J. Cell Biol. (2008).
  53. Pharmacol, B. rJ. 147, S172-S181 (2006).
  54. Slakey, L. L., Gordon, E. L., Pearson, J. D. A comparison of ectonucleotidase activities on vascular endothelial and smooth muscle cells. Ann. N.Y. Acad. Sci. 603, 366-378 (1990).
  55. Gordon, E. L., Pearson, J. D., Slakey, L. L. The hydrolysis of extracellular adenine nucleotides by cultured endothelial cells from pig aorta. Feed-forward inhibition of adenosine production at the cell surface. J. Biol. Chem. 261, 15496-15507 (1986).
  56. Moerenhout, M., Himpens, B., Vereecke, J. Intercellular communication upon mechanical stimulation of CPAE- endothelial cells is mediated by nucleotides. Cell Calcium. 29, 125-136 (2001).
  57. Ralevic, V., Burnstock, G. Receptors for purines and pyrimidines. Pharmacol. Rev. 50, 413-492 (1998).
  58. Edelhauser, H. F. The resiliency of the corneal endothelium to refractive and intraocular surgery. Cornea. 19, 263-273 (2000).
  59. George, A. J., Larkin, D. F. Corneal transplantation: the forgotten graft. Am. J. Transplant. 4, 678-685 (2004).
  60. Hong, S. J., Wu, K. Y., Wang, H. Z., Fong, J. C. Change of cytosolic Ca2+ mobility in cultured bovine corneal endothelial cells by endothelin-1. J. Ocul. Pharmacol. Ther. 19, 1-9 (2003).
  61. Crawford, K. M., MacCallum, D. K., Ernst, S. A. Histamine H1 receptor-mediated Ca2+ signaling in cultured bovine corneal endothelial cells. Invest. Ophthalmol. Vis. Sci. 33, 3041-3049 (1992).
  62. Crawford, K. M., MacCallum, D. K., Ernst, S. A. Agonist-induced Ca2+ mobilization in cultured bovine and human corneal endothelial cells. Curr. Eye Res. 12, 303-311 (1993).
  63. Srinivas, S. P., Yeh, J. C., Ong, A., Bonanno, J. A. Ca2+ mobilization in bovine corneal endothelial cells by P2 purinergic receptors. Curr. Eye Res. 17, 994-1004 (1998).
  64. Satpathy, M., Gallagher, P., Jin, Y., Srinivas, S. P. Extracellular ATP opposes thrombin-induced myosin light chain phosphorylation and loss of barrier integrity in corneal endothelial cells. Exp Eye Res. 81, 183-192 (2005).
  65. Srinivas, S. P., et al. Cell volume response to hyposmotic shock and elevated cAMP in bovine trabecular meshwork cells. Exp. Eye Res. 78, 15-26 (2004).
  66. D'hondt, C., Ponsaerts, R., De Smedt, H., Bultynck, G., Himpens, B. Pannexins, distant relatives of the connexin family with specific cellular functions. Bioessays. 31, 953-974 (2009).
  67. Boitano, S., Dirksen, E. R., Sanderson, M. J. Intercellular propagation of calcium waves mediated by inositol trisphosphate. Science. 258, 292-295 (1992).
  68. De Vuyst, E., et al. Intracellular calcium changes trigger connexin 32 hemichannel opening. EMBO J. 25, 34-44 (2006).
  69. De Vuyst, E., et al. Ca2+ regulation of connexin 43 hemichannels in C6 glioma and glial cells. Cell Calcium. 46, 176-187 (2009).
  70. Weissman, T. A., Riquelme, P. A., Ivic, L., Flint, A. C., Kriegstein, A. R. Calcium waves propagate through radial glial cells and modulate proliferation in the developing neocortex. Neuron. 43, 647-661 (2004).
  71. Iyer, S., Deutsch, K., Yan, X., Lin, B. Batch RNAi selector: a standalone program to predict specific siRNA candidates in batches with enhanced sensitivity. Computer Methods and Programs in Biomedicine. 85, 203-209 (2007).
  72. Stehberg, J., et al. Release of gliotransmitters through astroglial connexin 43 hemichannels is necessary for fear memory consolidation in the basolateral amygdala. Faseb J. 26, 3649-3657 (2012).
  73. Evans, W. H., Bultynck, G., Leybaert, L. Erratum to: Manipulating Connexin Communication Channels: Use of Peptidomimetics and the Translational Outputs. J. Membr. Biol. 245, 451 (2012).
  74. Majumder, P., et al. ATP-mediated cell-cell signaling in the organ of Corti: the role of connexin channels. Purinergic Signal. 6, 167-187 (2010).
  75. Carvalho, A. C., et al. affects intracellular Ca2+ stores and induces Ca2+ wave propagation. Cell Death Differ. 11, 1265-1276 (2004).
  76. Torres, A., et al. Extracellular Ca2+ acts as a mediator of communication from neurons to glia. Sci. Signal. 5, ra8 (2012).
  77. Decrock, E., et al. Transfer of IP(3) through gap junctions is critical, but not sufficient, for the spread of apoptosis. Cell Death Differ. 19, (3), 947-957 (2012).
  78. Beltramello, M., Piazza, V., Bukauskas, F. F., Pozzan, T., Mammano, F. Impaired permeability to Ins(1,4,5)P3 in a mutant connexin underlies recessive hereditary deafness. Nat. Cell Biol. 7, (1,4,5), 63-69 (2005).
  79. Bukauskas, F. F., Bukauskiene, A., Verselis, V. K. Conductance and permeability of the residual state of connexin43 gap junction channels. J. Gen. Physiol. 119, 171-186 (2002).
  80. Bukauskas, F. F., Verselis, V. K. Gap junction channel gating. Biochim. Biophys. Acta. 1662, 42-60 (2004).
  81. Dahl, G. Where are the gates in gap junction channels? Clin. Exp. Pharmacol. Physiol. 23, 1047-1052 (1996).
  82. Retamal, M. A., Schalper, K. A., Shoji, K. F., Bennett, M. V., Saez, J. C. Opening of connexin 43 hemichannels is increased by lowering intracellular redox potential. Proc. Natl. Acad. Sci. U.S.A. 104, 8322-8327 (2007).
  83. Shibayama, J., et al. Effect of charge substitutions at residue his-142 on voltage gating of connexin43 channels. Biophys. J. 91, 4054-4063 (2006).
  84. Desplantez, T., Verma, V., Leybaert, L., Evans, W. H., Weingart, R. Gap26, a connexin mimetic peptide, inhibits currents carried by connexin43 hemichannels and gap junction channels. Pharmacological Research: The Official Journal of the Italian Pharmacological Society. 65, 546-552 (2012).
  85. Delmar, M. Gap junctions as active signaling molecules for synchronous cardiac function. J. Cardiovasc. Electrophysiol. 11, 118-120 (2000).
הרבייה מכאנית מושרה גירוי סיד גל בmonolayers הסלולרי: דוגמה לתאי אנדותל קרני שור
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

D'hondt, C., Himpens, B., Bultynck, G. Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells. J. Vis. Exp. (77), e50443, doi:10.3791/50443 (2013).More

D'hondt, C., Himpens, B., Bultynck, G. Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells. J. Vis. Exp. (77), e50443, doi:10.3791/50443 (2013).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
Simple Hit Counter