Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identifikation af Cyclin-afhængig Kinase 1 specifikke fosforylering websteder ved en In Vitro -Kinase Assay

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Cyclin-afhængig kinase 1 (Cdk1) er aktiveret i G2 fase af cellecyklus og regulerer mange cellulære veje. Her præsenterer vi en protokol for en in vitro- kinase assay med Cdk1, som giver mulighed for identifikation af Cdk1-specifikke fosforylering websteder til oprettelse af cellulære mål for denne vigtige kinase.

Abstract

Cyclin-afhængig kinase 1 (Cdk1) er en master controller til cellecyklus i alle eukaryoter og phosphorylates anslås 8-13% af proteomet; men antallet af identificerede mål for Cdk1, især i humane celler er stadig lav. Identifikation af Cdk1-specifikke fosforylering websteder er vigtigt, da de giver mekanistiske indblik i hvordan Cdk1 kontrol af cellecyklus. Celle cyklus regulering er kritisk for trofaste kromosom opdeling, og mangler i denne komplicerede proces føre til kromosomforandringer og kræft.

Her, beskriver vi en in vitro- kinase assay, der bruges til at identificere Cdk1-specifikke fosforylering websteder. I denne analyse, et oprenset protein er fosforyleres i vitro af kommercielt tilgængelige menneskelige Cdk1/cyclin B. vellykket fosforylering er bekræftet af SDS-PAGE og fosforylering websteder er efterfølgende identificeret ved massespektrometri. Vi beskriver også rensning protokoller, der giver meget rene og homogen protein præparater egnet til kinase assay, og et bindende assay funktionelle verifikation af de identificerede fosforylering websteder, som sonder samspillet mellem en klassisk nukleare lokalisering signal (cNLS) og dens nukleare transport receptor karyopherin α. Hjælp med eksperimentelle design, gennemgår vi metoder til forudsigelse af Cdk1-specifikke fosforylering websteder fra protein-sekvenser. Sammen præsentere disse protokoller en meget kraftfuld tilgang, der giver Cdk1-specifikke fosforylering websteder og muliggør Mekanistiske undersøgelser i hvordan Cdk1 kontrol af cellecyklus. Da denne metode er baseret på rensede proteiner, kan det anvendes på enhver model organisme og udbytter pålidelige resultater, især når den kombineres med celle funktionelle studier.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinaser er enzymer, overføre fosfat grupper fra ATP på substrater og regulere mange cellulære processer. Denne fosforylering er reversibel, hurtigt, tilføjer to negative afgifter, og gemmer fri energi og er en af de mest almindelige posttranslationelle modifikationer bruges af celler. Cdk1, som er også kendt som celledeling cyklus protein 2 homolog (cdc2) er en master controller til cellecyklus i alle eukaryoter1,2,3,4,5, og phosphorylates en anslåede 8-13% af proteomet6,7.

Mens de seneste proteom undersøgelser har identificeret mange fosforylering websteder i proteiner, i de fleste tilfælde er kinase ansvarlig for disse ændringer ukendt. Antallet af kendte Cdk1 mål, især i humane celler er lav7. Identifikation af Cdk1-specifikke fosforylering websteder er vigtigt, da det giver Mekanistiske undersøgelser, at fastslå, hvordan Cdk1 kontrol af cellecyklus. Celle cyklus regulering er vigtig for trofaste kromosom segregation og celledeling, og et utal af cellulære processer skal ske for at støtte denne vigtige fysiologiske funktion. Dette omfatter standse transskription og translation forud for mitosen, såvel som en dramatisk reorganisering i cellulære struktur og organisation, som demontering af nukleare kuvert, kromosom kondens og mitotiske spindel forsamling. Deregulering og fejl i disse processer medføre kræft, fosterskader eller mitotiske celledød. Specifikke hæmmere af Cdk1 som RO-3306 var udviklede8, som give kraftfulde værktøjer for funktionelle studier, og nogle af disse inhibitorer er i øjeblikket i kliniske forsøg til behandling af cancer (Se9 til gennemsyn).

Her, beskriver vi en in vitro- kinase assay der tillader identifikation af Cdk1-specifikke fosforylering websteder. I denne analyse, er kommercielt tilgængelige menneskelige Cdk1/cyclin B bruges til at phosphorylate en renset target protein in vitro. Fosforylering af et substrat øger dens masse og tilføjer to negative afgifter; Derfor, vellykket fosforylering er bekræftet af en opadgående skift af protein gel band på SDS-PAGE. Cdk1-specifikke fosforylering websteder er efterfølgende identificeret ved massespektrometri analyse af in vitro- fosforyleret protein. Hjælp med eksperimentelle design, gennemgå vi også beregningsmæssige redskaber og referencer til forudsigelse af Cdk1-specifikke fosforylering websteder fra protein sekvens. Derudover beskriver vi også rensning protokoller, der giver meget rene og homogen protein præparater egnet til kinase assay. Endelig identificeret fosforylering websteder skal verificeres af funktionelle studier, og en enkel bindende assay er beskrevet her til dette formål. Kombinerede, er dette en meget kraftfuld tilgang, der giver Cdk1-specifikke fosforylering websteder og muliggør Mekanistiske undersøgelser i hvordan Cdk1 styrer celle cyklus7,10,11. Da denne metode er baseret på rensede proteiner, kan det anvendes på enhver model organisme og udbytter pålidelige resultater. Dog funktionelle verifikation af opnåede fosforylering websteder i vitro anbefales, da cellerne har yderligere lovgivningsmæssige mekanismer på plads, såsom posttranslationelle modifikationer, interaktion partnere eller cellulære lokalisering, kan gengive fosforylering websteder tilgængelige eller utilgængelige for anerkendelse af Cdk1.

Cdk1 genkender en konsensus fosforylering websted, der består af (Ser/Thr-Pro-X-Lys/Arg), hvor X er nogen rester og en Serin eller Threonin er stedet for fosforylering. Især vigtigt for anerkendelse er tilstedeværelsen af prolin i positionen + 1. Desuden grundlæggende restkoncentrationer foretrækkes i + 2 eller 3 positioner, med de fleste Cdk1-specifikke fosforylering websteder, der indeholder en Lys eller Arg på + 3 Placer6,12.

Aktivering af Cdk1 er stramt reguleret og fører til udbrud af mitosen1,2,3,4,5. Aktiviteten af cyclin-afhængig kinaser afhænger generelt af deres tilknytning til forskellige cyclins (cyclin A, B, C, D og E i mennesker), som er udtrykt på oscillerende niveauer i hele cellecyklus13. Cdk1 udtryk er konstant i hele cellecyklus og regulering af dens aktivitet er afhængig af sin tilknytning til de lovgivningsmæssige underenheder cyclin A og cyclin B5,13,14,15, som samt posttranslationelle modifikationer. Dannelsen af Cdk1/cyclin B kompleks er nødvendig for kinase aktivering5,14,15,16,17,18. I fasen G2 er cyclin B oversat i cytosol og importeres til kernen hvor det binder sig til Cdk15,14,15,16,17,18; men Cdk1/cyclin B afholdes inaktiveret ved fosforylering på rester Thr14 og Tyr15 af de menneskelige Cdk1-hæmmende kinaser Myt1 (membran-associerede tyrosin og Threonin-specifikke cdc2-hæmmende kinase) og Wee1, henholdsvis19, 20,21. I den sene G2 fase, dephosphorylation af Thr14 og Tyr15 ved celledeling cyklus 25 fosfatase (cdc25) aktiverer kinase aktivitet af Cdk1/cyclin B kompleks og udløser indledningen af mitosen12,14, 18 , 20 , 22 , 23. fosforylering af Thr161 er også påkrævet til Cdk1/cyclin B aktivering og er medieret af Cdk7, aktivering af Cdk kinase (KAG)18. Nedbrydning af cyclin B i anaphase inaktiverer Cdk1, tillader exit fra mitosen24,25. Aktivering af Cdk1/cyclin B er derfor en kompliceret proces. Protokollen præsenteres her er udført med kommercielt tilgængelige Cdk1/cyclin B. Under rekombinant udtryk for dette kompleks i insekt celler, det er aktiveret i vivo endogene kinaser14,20 og forbliver aktive i den rensede tilstand. Den resulterende aktive, rekombinant human Cdk1/cyclin B er velegnet til in vitro- kinase assays.

Her, beskriver vi en protokol for kortlægning af Cdk1 specifikke fosforylering websteder i menneskelige centromer protein F (CENP-F)10. CENP-F er et kinetochore protein, der findes i kernen i det meste af interphase (G1 og S-fasen) og eksporteres til cytosol i G2 fase26,27,28 i en Cdk1-afhængige måde10, 11. nukleare lokalisering er tillagt en todelt cNLS26. cNLSs genkendes af nukleare transport faktor karyopherin α, som letter karyopherin β og RanGDP, import af cNLS-cargo til kernen29. Nuklear eksport i fasen G2 lettes via en ukendt eksport vej10. Når CENP-F er placeret i cytosol, det er rekrutteret til den nukleare kuvert og rekrutter igen motor protein kompleks dynein30,31. Denne vej er vigtigt at placere den respektive til centrosome kerne i indledende faser af mitotiske spindel forsamling i dynein-afhængige måde, hvilket er vigtigt for den korrekte timing af mitotiske post og en grundlæggende proces i hjernen udvikling30,31,32. Starter i fasen for G2, er CENP-F også samlet i kinetochore hvor det har vigtige roller for trofaste kromosom segregation27,28,33,34,35 . Et centrale lovgivningsmæssige skridt af disse veje er den nukleare eksport af CENP-F i G2 fase, som er afhængige af Cdk110,11. Vi beskriver her en protokol for kortlægning af Cdk1 specifikke fosforylering websteder i cNLS af CENP-F. Phosphomimetic mutationer af disse websteder bremse nukleare import af CENP-F, tyder på, at Cdk1/cyclin B direkte regulerer cellulære lokalisering af CENP-F ved fosforylering af sin cNLS10.

Samlet set tillader denne in vitro- kinase assay identifikation af specifikke substrater for kinase Cdk1. renset target proteiner er fosforyleres i in vitro af de kommercielt tilgængelige Cdk1/cyclin B kompleks og fosforylering websteder er efterfølgende identificeret ved massespektrometri. Identifikation af Cdk1-specifikke fosforylering websteder understøtter Mekanistiske undersøgelser, der afslører, hvordan Cdk1 kontrol af cellecyklus.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. forudsigelse af Cdk1-specifikke fosforylering websteder fra Protein sekvens

  1. Før du begynder kinase assay, analysere protein sekvensen for forventede Cdk1-specifikke fosforylering websteder og Søg litteratur for eksperimentelt etablerede fosforylering websteder med ukendt kinase specificitet. Brug følgende værktøjer, databaser og referencer, der opsummeres.
    1. Bruge BGB 3.0 software36,37 (http://gps.biocuckoo.org/online_full.php) til at forudsige Cdk1-specifikke fosforylering websteder i target protein sekvens. Brug linket her for en omfattende forudsigelse, der omfatter anmærkninger af sekundær struktur og overflade tilgængelighed.
    2. I programmet, indtaste protein sekvens i FASTA format. For kinase specificitet, kontrollere Serin/Threonin kinase, CMGC, CDK, CDC2, CDK1og uncheck alle andre særlige forhold. Vælg medie som grænse og klikker på knappen Send .
    3. Undersøg de resulterende forventede websteder med Cdk1 konsensus fosforylering websted (Ser/Thr-Pro-X-Lys/Arg).
    4. Vigtigere, kontrollere webstedet forudsagt for prolin ved siden af fosforyleres rester (nogle Cdk1 substrater er fosforyleret på en minimal websted (Ser/Thr-Pro)6,12). Derudover kontrollere for grundlæggende restkoncentrationer, der foretrækkes i + 2 eller 3 positioner, med de fleste Cdk1-specifikke fosforylering websteder, der indeholder en Lys eller Arg på + 3 position6,12.
  2. Check, at webstedet er tilgængeligt for anerkendelse, som tilstedeværelsen af en fuld konsensus site er heller ikke tilstrækkeligt for Cdk1 fosforylering.
    1. Inspicere overflade tilgængelighed og sekundær struktur forudsigelse anmærkning i BGB output, hvoraf det fremgår, om webstedet er forudsagt til at være tilgængelig N - og C-termini af proteiner er i mange tilfælde fleksibel og tilgængelig for fosforylering.
    2. Hvis en X-ray struktur af target proteinet er tilgængelige, kontrollere tilgængelighed af formodede fosforylering websteder ved inspektion af deres placering i strukturen.
  3. Søg litteratur for eksperimentelt etablerede fosforylering websteder med ukendt kinase specificitet ved hjælp af UniProtKB/Swiss-Prot database38 (http://www.uniprot.org).
    1. Angiv navnet på proteinet i søgefeltet og klik på knappen Søg . Vælg den korrekte sekvens post. Fosforylering websteder er kommenteret og der refereres til i afsnittet aminosyre ændringer .
    2. Søgning efter proteomics undersøgelser af mitotiske uddrag af humane celle linjer7,39,40, som er især nyttige, fordi Cdk1 bliver aktiv i G2 fase af cellecyklus.
  4. Identificere todelt cNLS af NLSmapper (valgfri).
    Bemærk: For proteiner, der shuttle mellem cytosol og kernen, er en fælles mekanisme til regulering af cellulære lokalisering fosforylering af en todelt cNLS i positionen-1 stort motiv af Cdk1. Fosforylering afskaffer nukleare lokalisering i G2 fase10,41,42,43.
    1. For sådanne shuttling proteiner, identificere cNLS i protein sekvens af NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Indsæt protein sekvens som tekst i boksen rækkefølge og vælge en cut-off score på 5,0 vælger at søge efter NLS i hele regionen. Klik på knappen Forudsige NLS .
    2. Sammenligne den resulterende forventede cNLS mod konsensus sekvens af en todelt cNLS, som består af de mindre motiv (Lys-Arg), en linker af mindst 10 restkoncentrationer og den store motiv (Lys-Lys/Arg-X-Lys/Arg), hvor X er eventuelle rester, der ikke er negativt ladede .
    3. Kontrollere hvis den forudsagte Cdk1 fosforylering site (*) er beliggende støder op til den store motiv af linker-1 stilling: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Bemærk: Fosforylering af en todelt cNLS i-1 position af Cdk1 blev etableret som en reguleringsmekanisme for cellulære lokalisering for flere shuttling proteiner10,41,42, 43.

2. angivelse af rekombinante proteiner i Escherichia Coli

  1. Bruge udtrykket plasmider fra trin 2.1.1-2.1.2 til udtryk for rekombinante proteiner i E. coli.
    1. Hvis du vil oprette den menneskelige CENP-F (restprodukter fra 2,987-3,065) udtryk konstruere, generere skær ved at forstærke DNA-fragmenter ved polymerase kæde reaktion (PCR) fra en fuld længde CENP-F konstruktion (GenBank tiltrædelse: U19769.1). Brug de følgende primere: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG og AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Bemærk: Den fuld længde menneskelige CENP-F plasmid blev generøst leveret af Dr. X. Zhu, institutter for biologiske videnskaber, kinesiske Academy of Sciences, Shanghai, Kina.
      1. Klon insertet i pGEX6p1 vektor med BamHI og XhoI begrænsning websteder. Brug denne plasmid give udtryk for N-terminale glutathion S-transferase (GST) fusion proteiner i CENP-F (restprodukter fra 2,987-3,065).
        Bemærk: GST-tag kan være kløvet ud af den PreScission protease (herefter benævnt PS protease).
    2. For den menneskelige karyopherin α udtryk konstruere, generere skær ved at forstærke DNA fragmenter af PCR fra en fuld længde karyopherin en2 cDNA skabelon (sekvens tiltrædelse NM_002264.3; primere: GCACTACATATGTCCACCAACGAGAATGCTAATA og TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Bemærk: På grund af ligheden af isoformer, denne karyopherin en2 konstruere kaldes i den efterfølgende tekst karyopherin α.
      1. Klon insertet i pET28a-pres vektor med NdeI og XhoI begrænsning websteder.
        Bemærk: Dette er en modificeret pET28a vektor hvor sekvens kodning for thrombin kavalergang websted blev erstattet af en sekvens, der koder for en PS protease kavalergang websted. Brug denne plasmid til at udtrykke en fusion protein af karyopherin α med en N-terminale hans6-tag, hvor de hans6-tag kan være kløvet ud af PS protease.
  2. Udfør for at oprette punktmutationer en target protein, site-directed mutagenese med et kit.
  3. Udtrykke de rekombinante proteiner i E. coli for efterfølgende rensning.
    1. Gøre følgende bestande: 50 mg/mL kanamycin (1:1, 000 stamopløsning), 35 mg/mL chloramphenicol i 70% Ethanol (1:1, 000), 100 mg/mL ampicillin (1:1, 000), og 1 M isopropyl β-D-1-thiogalactopyranoside (IPTG; 1:5, 000).
    2. Sterilt filtrere bestandene og opbevares ved-20 ° C. Undgå gentagne fryse-tø cykler for IPTG.
    3. Omdanne 1 µL af udtryk plasmid til 50 µL af kompetente celler af E. coli Rosetta 2 (DE3) pLysS stamme, ifølge producentens anvisninger.
    4. Plade kultur på Luria-Bertani (LB) agar med chloramphenicol (35 µg/mL LB) og ampicillin (100 µg/mL LB) for CENP-F konstruere eller chloramphenicol og kanamycin (50 µg/mL kultur) for karyopherin α konstruktion. Inkuber plader i 12-20 timer ved 37 ° C.
    5. Vælge en enkelt koloni og podes 50 mL af LB suppleret med antibiotika (Se trin 2.3.4). Inkubér preculture mens ryste på 160-180 rpm i 12-20 timer ved 37 ° C.
    6. Forberede 1 L af LB medium i en 2.800 mL forvirret Fernbach kolbe. Gøre to kolber for hver preculture og autoklave dem. Hvis du vil tillade beluftning, Fyld ikke kolber til mere end to tredjedele kolbe volumen. Erlenmeyerkolben kolber kan bruges som godt.
    7. Tilsættes antibiotika (trin 2.3.4) og 10 mL af en steril-filtreret 40% (w/v) glukose løsning pr. 1 liter afkølet LB. tilføje 20 mL preculture pr. 1 L af LB medium.
      Bemærk: Absorbans på 600 nm på en 1:10 fortynding af preculture bør være mellem 0,15-0,2.
    8. Inkuber kolberne mens ryste på 160-180 rpm ved 37 ° C. Absorbansen måles på 600 nm af bakterier kultur regelmæssigt. Hvis absorbansen når 0,5-0,6, fremkalde protein udtryk ved at tilføje 0,2 mM IPTG (200 µL 1 M lager pr. 1 L af LB medium).
      Bemærk: Det er vigtigt, at cellerne er induceret på den korrekte absorbans. Det tager normalt 3-4 h at nå frem til dette stadium.
    9. Inkuber kolberne mens ryste i 3 timer ved 37 ° C. Høste cellerne ved centrifugering (15 min, 4,100 x g, 4 ° C, swing-out rotor). Supernatanten. Resuspend celle pellets i 20 mL GST-binding buffer (CENP-F) eller hans6-binding buffer (karyopherin α) per 1 L af kultur. Gemme celler ved-80 ° C.
      1. Forberede GST-binding buffer (10 mM Tris pH 8,0 ved 25 ° C, 150 mM NaCl, 1 mM dithiothreitol (DTT), 0,5 mM EDTA) og hans6-binding buffer (10 mM Tris pH 8,0 ved 25 ° C, 250 mM NaCl, 5 mM imidazol pH 8,0, 5 mM β-mercaptoethanol (BME)) på forhånd.

3. oprensning af rekombinante Protein af glutathion-affinitet kromatografi og Gel filtrering

  1. Gøre følgende bestande: 1 M DTT (1:1, 000 lager, sterile filtreret med 0,2 µM porestørrelse, og afgasses); 250 mM phenylmethylsulfonyl fluorid (PMSF; 1:1,000 lager i dimethylsulfoxide). Opbevares ved-20 ° C. Undgå gentagne fryse-tø cykler.
  2. Gøre de følgende buffere og køle dem til 4 ° C.
    1. Forberede GST-binding buffer ved hjælp af 10 mM Tris pH 8,0 ved 25 ° C, 150 mM NaCl, 1 mM DTT, 0,5 mM EDTA.
    2. Forberede GST-eluering buffer ved hjælp af 10 mM reduceret glutathion (0,15 g/50 mL) opløst i en buffer på 50 mM Tris pH 8,0 ved 25 ° C, 150 mM NaCl, 1 mM DTT. Bekræfte, at den endelige buffer pH 8.0 og bruge den samme dag blev det gjort.
    3. Forberede Gel-filtrering buffer ved hjælp af 20 mM Tris pH 7,5 ved 25 ° C, 60 mM NaCl, 2 mM DTT. Sterilt filtrere bufferen med en flaske-top filter (0,2 µM porestørrelse). Degas buffer under omrøring under vakuum (-6 psi) i 15 min.
    4. Tilføje DTT for alle ovenstående buffere på dagen for brug.
  3. Optø de celler fra afsnit 2, der indeholder CENP-F-konstruktionen. Regulér lydstyrken til 40 mL med GST-binding buffer. Tilføj 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0,5 M stamopløsning, pH 8,0), 7 mg benzamidine hydrochlorid (1 mM) og 40 mg D/L methionin.
    Bemærk: For at reducere proteolytisk nedbrydning, udføre alle trin ved 4 ° C, fortrinsvis i et kølerum, medmindre andet er angivet. Hold celler, lysates og renset protein fraktioner på is på alle tidspunkter, og tilføje proteasehæmmere. For at undgå oxidation af cystein og methionin restkoncentrationer, tilføje reduktionsmidler DTT og methionin på dagen af forsøget. For at reducere proteolytisk nedbrydning, arbejde gennem trinene hurtigt.
  4. Lyse celler i en sonikator som følger. Fyld et glas bægerglas med den lysate og fordybe den i et bad med is vand. Der sonikeres kultur (1 min 40 s, på 100 W (50%) output/amplitude, med 10 s pulser og 10 s resten cyklusser). Tilføje 250 µM PMSF efter ultralydbehandling. Inspicere den celle lysate, som bør kigge mere gennemsigtig og ikke længere være tyktflydende.
  5. Klart den lysate ved centrifugering på 12.000-40.000 x g, 25 min, 4 ° C. Bruge runde-bunden centrifugeglas og en fast vinkel rotor.
  6. Udføre ækvilibrering ved tilsætning 2 mL af glutathion Agarosen 1:1 gylle til en engangs kromatografi kolonne. Den resulterende kolonne vil have et volumen på 1 mL. Kolonnen udvaskes med 25 mL i ultrarent vand og 25 mL af GST-binding buffer.
  7. Udføre bindende som følger. Arbejde i et koldt rum eller kolde boks, dekanteres lysate fra pellets. Filtrere de lysate (0,2 µm porestørrelse) og hæld det over på sat kolonnen. Cap kolonnen og inkuberes det mens du forsigtigt nutating i 30 min. ved 4 ° C.
  8. At vaske Lad kolonnen, sætte det på en rist, harpiks bosætte sig, og indsamle flow gennem. Kolonnen udvaskes to gange med 25 mL af GST-binding buffer.
  9. Elueres af proteolytiske kavalergang.
    1. Sæt kolonnen. Tilføj 400 µL af GST-binding buffer og 250 µL af PS protease (2 mg/mL bestand med en aktivitet på 1.000 U/mg, enten renset i laboratoriet eller købt, se Tabel af materialer).
    2. Cap kolonnen og forsigtigt hvirvel for at resuspend harpiks i bufferen. Inkuber kolonner for 16-20 h ved 4 ° C. Derefter tilsættes 4 mL af GST-binding buffer at eluere proteolytically kløvet CENP-F fragmentet fra kolonnen.
  10. Glutathion eluering
    1. Tilslutte kolonnen, tilsættes 4 mL af GST-eluering buffer (4 kolonne diskenheder), og der inkuberes i 10 min at eluere bundne GST-tag. Eluatet opsamles. Regenerere kolonner inden de bruges igen, som beskrevet af fabrikanten.
  11. Analysere PS protease eluering fraktion og glutathion eluering brøkdel af SDS-PAGE på 16% acrylamid geler. Udføre elektroforese på 25 V/cm til 45 min. pletten geler ved Coomassie Blue. PS protease brøkdel vil indeholde den rensede CENP-F fragment, mens glutathion brøkdel vil indeholde kløvet GST-tag. Inspicere gel for at vurdere proteolytiske kavalergang effektivitet.
  12. Koncentrere PS protease eluatet til 0,5 mL ved hjælp af centrifugal filter enheder med en 3 kDa molekylvægt cutoff (Se Tabel af materialer). Tilføje eluatet i det øverste rum af filteret, og der centrifugeres det i 10-15 min. intervaller på 4.100 x g, 4 ° C (swing-out rotor) at koncentrere prøvens. Mix af pipettering efter hver tilvækst.
  13. Tilslut en egnet gel filtrering kolonne (Se Tabel af materialer købt oplysninger) til en hurtig protein væskekromatografi (FPLC) system, og Blandingen henstår det med 1 kolonne volumen af gel filtrering buffer.
  14. Der centrifugeres koncentreret CENP-F fragmentet i en microcentrifuge (20 min, 21,700 x g, 4 ° C). Sæt prøven på kolonnen og elueres det med 1 kolonne volumen af gel filtrering buffer. Indsamle 0,6 mL fraktioner.
    Bemærk: Gel filtrering buffer er optimeret for kompatibilitet med efterfølgende kinase assay. Test hvis target proteinet er stabilt i denne buffer. Hvis det ikke er stabil, kan du prøve at tilføje flere natriumchlorid.
  15. Analysere peak fraktioner af SDS-PAGE (trin 3.11). Pool peak fraktioner, der indeholder ren CENP-F fragmenter. Koncentrere de renset CENP-F fragmenter til 3,3 mg/mL (trin 3.12). Analysere de renset CENP-F fragmenter af SDS-PAGE (trin 3.11).
  16. Protein koncentration bestemmelse
    1. Fortynd prøven 1: 100 i ultrarent vand og læg den i et quartz mikro-kuvette. Optag spectra på en bølgelængdeområdet af 220-300 nm i et spektrofotometer.
      Bemærk: Protein koncentration c (mg/mL) er udledt af følgende ligning:
      Equation
  17. Gøre 50 µL delprøver af oprenset protein i 0,5 mL microtubes og flash-fryse dem i flydende kvælstof. Gemme alikvoter ved-80 ° C.

4. oprensning af rekombinante Protein ved Ni-NTA affinitet kromatografi

  1. Gøre de følgende buffere og afkøles til 4 ° C.
    1. Forberede den hans6-binding buffer ved hjælp af 10 mM Tris pH 8,0 ved 25 ° C, 250 mM NaCl, 5 mM imidazol pH 8,0, 5 mM BME. Tilføje BME til alle buffere på dagen for brug.
    2. Forberede den hans6-wash buffer på samme måde som hans6-bindende buffer, men ved hjælp af 20 mM imidazol.
    3. Forberede den hans6-eluering buffer på samme måde som bindende buffer, men bruger 150 mM imidazol.
  2. Optø cellerne fra afsnit 2, der indeholder karyopherin α konstruere og justere lydstyrken til 40 mL med hans6 -binding buffer. Tilføj 5 mM BME, 0.250 mM PMSF, 7 mg benzamidine hydrochlorid (1 mM) og 40 mg D/L methionin.
    1. Fortsæt som beskrevet i trin 3,4-3,8 med følgende variationer: bruge hans6-binding buffer i stedet for GST-binding buffer for alle trin. I stedet for glutathion agarosegelelektroforese, bruge 4 mL af nikkel affinitet gel (Se Tabel af materialer) for at gøre kolonnen, som vil have en kolonne volumen på 2 mL.
      Bemærk: Nikkel affinitet kolonner er uforenelig med DTT og EDTA. I stedet for nikkel affinitet gel, Ni2 +- nitrilotrieddikesyre syre (NTA) Agarosen kan bruges, hvis koncentrationen af imidazol i eluering buffer er steget til 250 mM (Se Tabel af materialer).
  3. Vask det kolonner med 8 mL af hans6-wash buffer.
  4. Elute karyopherin α med 12 mL af hans6-eluering buffer og analysere eluatet af SDS-PAGE (trin 3.11).
  5. Tilføje 250 µL af PS protease (trin 3.9) til eluatet og Inkuber i 16-20 h ved 4 ° C. I mellemtiden dialyze eluatet to gange mod 1 L hans6-binding buffer til 2-20 h, ved hjælp af en dialyse membran med en 6-8 kDa molekylvægt cutoff.
  6. Regenerere kolonnen nikkel affinitet gel, som beskrevet af fabrikanten. Blandingen henstår kolonnen med 25 mL af hans6-binding buffer. Tilføje dialyzed protein til kolonnen og udføre bindende trin som beskrevet i trin 3.7.
  7. Indsamle flow gennem, som indeholder renset karyopherin α (med hans6-tag kløvet), og elueres den resterende protein med en yderligere 4 mL af hans6-binding buffer. Samle disse fraktioner. Derefter elueres kolonner med 12 mL af hans6-eluering buffer. Denne fraktion indeholder urenheder.
  8. Analysere uncleaved og kløvet karyopherin α fra trin 4.4-4.5 og de to eluering fraktioner fra dette trin af SDS-PAGE (trin 3.11) til at evaluere effektiviteten af hans6-tag kavalergang og renhed.
  9. Koncentrere karyopherin α til 8 mg/mL og flash-freeze i flydende kvælstof (trin 3.15-3.17).

5. in Vitro Kinase Assay med Cdk1/Cyclin B

  1. In vitro kinase assay
    Bemærk: Ved ankomsten af kinase gøre små prøver, flash-fryse dem i flydende nitrogen og opbevar dem ved-80 ° C. Brug inden for 6 måneder. Mens Molekylær vægten er 34 kDa for Cdk1 og 48 kDa for cyclin B, er tilsyneladende molekylvægt af cyclin B på SDS-PAGE ca. 60 kDa.
    1. Forberede 10 x PK buffer (leveres med kinase) ved hjælp af 0,5 M Tris-HCl, 0,1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0,1% Annemette 35, pH 7,5 ved 25 ° C.
    2. Forberede 10 x ATP lager: gør en løsning af 4 mM ATP i 1 x PK buffer, og tjek den endelige pH af bestanden. Lagre i små alikvoter ved-20 ° C og undgå at fryse-tø cykler.
    3. Mix 40 µL af CENP-F fragment (ved en koncentration på 3,3 mg/mL eller 400 µM), 6 µL 10 x PK buffer, 3 µL ultrarent vand, 6 µL ATP 10 x lager og 5 µL humant Cdk1/cyclin B (1 µg, 100 U) i en 0,5 mL microtube.
      Bemærk: CENP-F Fragmentet har en molar masse 8,6 kDa og fire Cdk1-specifikke fosforylering websteder. For en ny substrat, justere kinase koncentration i analysen den molære koncentration af protein og antallet af fosforylering websteder. Aktiviteten af menneskelige rekombinante Cdk1/cyclin B bestanden er 20.000 U/mL, og den specifikke aktivitet er 1.000.000 U / mg. 1 U er defineret som mængden af Cdk1/cyclin B kræves til katalyserer overførslen af 1 pmol af fosfat til Cdk1 peptid substrat PKTPKKAKKL-NH2 (50 µM) i 1 min. ved 30 ° C (Se Tabel af materialer).
    4. Forberede en kontrol reaktion uden Cdk1/cyclin B. Incubate reaktioner i et vandbad i 1-16 timer ved 30 ° C.
  2. Analysere 2,5 µL af kinase assay reaktionen og 2,5 µL af kontrol af SDS-PAGE (trin 3.11), ved hjælp af en gel med 16% acrylamid. For at øge opløsningen, udvide den køretid.
  3. Tilføje et lige saa stort volumen af 6 M guanidin hydrochlorid løsning til de resterende kinase assay reaktion (og kontrol). Den endelige guanidin hydrochlorid koncentration vil være 3 M. analysere disse prøver ved massespektrometri (afsnit 6) til at identificere fosforylering websteder eller sende prøverne til en massespektrometri facilitet med henblik på analyse og derefter udføre funktionen verifikation ( Afsnit 7).
    Bemærk: For den efterfølgende massespektrometri analyse, det er meget vigtigt, at fosforylering effektiviteten af de enkelte sites er så højt som muligt, helst 100%, som ellers fosforylering websteder kan ikke tilknyttes. Du kan i høj grad forbedre fosforylering effektivitetsgevinster, tilføje større mængder af Cdk1/cyclin B og øge inkubationstiden til 16 h. Koncentrationen af ATP kan også fordobles.
  4. I forbindelse med fejlfinding, skal du udføre en in vitro- kinase analyse af CENP-F (restprodukter fra 2,987-3,065) som en positiv kontrol. Bruge friske partier af Cdk1/cyclin B med høj aktiviteter.

6. identifikation af Cdk1-specifikke fosforylering websteder af massespektrometri

  1. At denaturere og desalt protein prøver, udføre microbore omvendt fase væskekromatografi med en kolonne med PLRP300.
  2. For at få antallet af fosforylering websteder i CENP-F fragment, analysere den intakte i vitro fosforyleret CENP-F 84-mer electrospray Ionisation ion trap massespektrometri (ESI-ITMS)44,45.
  3. For at vurdere phosphoamino syre site placering af CENP-F, fosforyleret forberede trypsin fordøjer af in vitro- CENP-F protein prøver. Desalt trypsin fordøjer med afsaltning pipette tips.
  4. Analysere CENP-F tryptic fordøjer af electrospray Ionisation Fourier transform ion cyclotron resonance massespektrometri (ESI-FTICR MS). Udføre analyse på en ESI-FTICR massespektrometer med en akkumulering tid 169 µs.
    Bemærk: Nøjagtigheden af masserne bestemmes af ESI-FTICR MS er højst 0,005 amu. For at kvantificere forholdet mellem hver fosforyleres arter respektive til beløbet, samlede proteinindhold, bestemme tophøjder af de massespektre.

7. funktionelle verifikation: Prøvning virkningerne af Phosphomimetic mutationer på Protein-protein interaktioner ved analytisk størrelse udstødelse kromatografi

Bemærk: For funktionelle verifikation af de identificerede Cdk1-specifikke fosforylering sites, phosphomimetic mutanter af CENP-F fragmenter blev skabt ved at erstatte de identificerede fosforylering steder med aspartates. Den negative ladning af aspartat efterligner effekten af fosforylering. En S3048D mutant CENP-F Fragmentets (restprodukter fra 2,987-3,065) blev oprettet.

  1. Funktionel kontrol, sammenligne bindingen af wild-type og phosphomimetic CENP-F fragmenter til karyopherin α. bruge en analytisk gel filtrering som bindende assay. For den analytiske gel filtrering, rense CENP-F fragmenter af glutathion affinitet kromatografi (trin 3.1-3.12), og springe gel filtrering trin.
  2. Koncentrere protein til 5-6 mg/mL. Flash-freeze protein delprøver i flydende kvælstof (trin 3.15-3.17).
  3. Mix renset CENP-F fragmenter (0,1 mg, enten wild-type eller S3048D varianten) og renset karyopherin α (0,7 mg) i forholdet 1:1 molar. Justere sample volumen til 200 µL med gel filtrering buffer. Inkuber prøve for 30 min på is, filtrere prøve (0,2 µm porestørrelse) og klare prøven ved centrifugering (25 min, 21,700 x g, 4 ° C)
  4. Adskille den stikprøve af størrelse udstødelse kromatografi (trin 3,13 3,14). Anvende en gel filtrering buffer bestående af 20 mM HEPES, pH 7,5, 150 mM NaCl, og 2 mM DTT. Udføre de analytiske gel filtrering forsøg på ens betingelser for alle prøver.
  5. Kalibrere den analytiske gel filtrering kolonne med molekylvægt standarder af kendt molar masse, som beskrevet af fabrikanten.
  6. Analysere eluering fraktioner af 16% SDS-PAGE (trin 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Vi har for nylig brugt en in vitro- kinase assay (figur 1) til at identificere Cdk1-specifikke fosforylering websteder i en CENP-F-fragment, der indeholdt en cNLS10. Dette signal giver nukleare lokalisering af CENP-F i det meste af interfasen. I fasen for G2 eksporteres CENP-F fra kernen til cytosol i en Cdk1-afhængige måde. For at opnå mekanistiske indsigt på hvordan Cdk1 regulerer cellulære lokalisering af CENP-F, analyserede vi sekvensen af CENP-F til at forudsige Cdk1-specifikke fosforylering websteder, ved hjælp af BGB server36,37. Inden for cNLS af CENP-F, tre Cdk1-specifikke fosforylering websteder blev forudsagt på rester 3,042, 3045, og 3,048 (tabel 1). En anden Cdk1-specifikke fosforylering site var også forudsagt for restkoncentrationer 3,007 (tabel 1)10. Derfor, vi hypotese at Cdk1 regulerer CENP-F lokalisering direkte ved fosforylering af sin cNLS.

At teste, om cNLS af CENP-F er et substrat for Cdk1, vi udførte en in vitro- kinase assay med renset menneskelige CENP-F fragmentet (restprodukter fra 2,987-3,065) og menneskelige Cdk1/cyclin B. In vitro fosforyleret CENP-F blev analyseret på 16% SDS-PAGE, en negativ kontrol, der manglede kinase Cdk1 (figur 2A)10. Til i vitro fosforyleret CENP-F, observeret en klart opadgående Skift til bandet på gelen i forhold til den negative kontrol. Dette er typisk for fosforyleres proteiner, som hver fosfat gruppen tilføjer to negative afgifter og yderligere masse. Disse resultater tyder på, at CENP-F er fosforyleret af Cdk1/cyclin B10.

Til at bestemme antallet af CENP-F fosforylering websteder og kvantificere fosforylering effektiviteten af disse websteder blev intakt i vitro fosforyleret CENP-F fragmentet (84-mer) analyseret af massespektrometri (ESI-ITMS)10. Den observerede ESI-ion trap masse spektrum (figur 2B) tyder på, at den intakt CENP-F fragment er fosforyleret på fire lokaliteter (tabel 1)10.

Placeringen af fosforyleres aminosyre sites i rækkefølgen af CENP-F blev vurderet ved at undersøge tryptic fordøjer af ESI-FTICR MS. Trypsin kløver proteinkæder efter lysines og arginines, og en trypsin udtog af CENP-F fragmentet resulterede i flere peptider, herunder en, der indeholdt rester 3,031-3, 052. Massespektre af denne CENP-F peptid var i overensstemmelse med fosforylering på rester T3042, T3045 og S3048, som ligger inden for cNLS (tabel 1)10. Massespektre af en anden tryptic peptid (restprodukter fra 2,995-3,016) var i overensstemmelse med fosforylering på S3007 (tabel 1)10. Alle fire Cdk1-specifikke fosforylering websteder blev også forudsagt fra sekvens. Cdk1-specifikke substrater indeholder ofte en prolin ved siden af den rest, som er fosforyleres6, som observeres for restkoncentrationer T3042, T3045 og S3007. Det skal bemærkes, at S3048 er en noget usædvanlig Cdk1-specifikke fosforylering site, som en phenylalanin er beliggende ved siden af serin. Afslutningsvis tyder resultaterne på, at CENP-F specifikt fosforyleret på rester 3,007, 3,042, 3.045 og 3,048 af kinase Cdk1. Tre af disse rester er beliggende inden for cNLS af CENP-F (tabel 1), der angiver, at Cdk1 kan regulere CENP-F cellulære lokalisering gennem fosforylering af cNLS i G2 fase, når Cdk1 bliver aktiv10.

For at kontrollere, at disse Cdk1-specifikke fosforylering websteder har en fysiologisk funktion, skabt vi den phosphomimetic variant S3048D10. Phosphomimetic mutationer efterligner virkningen af fosforylering af negativt ladede rester. Næste, vi renset phosphomimetic versionen af CENP-F-fragment, der indeholdt cNLS. CNLS af CENP-F er anerkendt af nukleare transport receptor karyopherin α, der binder med høj affinitet og kræves for nukleare import af CENP-F. For at teste, om phosphomimetic mutation svækker interaktionen mellem cNLS af CENP-F med sine nukleare transport receptor karyopherin α, udført vi en bindende assay (figur 3)10. I disse eksperimenter, en renset CENP-F fragment (wild-type eller S3048D varianten) var blandet med oprenset humant karyopherin α, og blandingen var adskilt af analytisk størrelse udstødelse kromatografi. Derudover var proteiner også analyseres individuelt. SDS-PAGE analyse af eluering fraktioner afslørede, at wild-type CENP-F fragment med cNLS interagerer kraftigt med karyopherin α, da begge proteiner Co elueres (figur 3)10. Imidlertid kun en ubetydelig mængde af CENP-F S3048D fragment binder sig til karyopherin α, og disse proteiner elueres separat (figur 3)10. Disse resultater tyder på, at fosforylering af rest 3,048 af cNLS af CENP-F ville have en stærk virkning på samspillet med nukleare transport faktor karyopherin α. Det skal bemærkes, at nukleare import priser er meget afhængig af affiniteten af en nuklear lokalisering signal til en nuklear transport faktor46, og det forventes derfor, at disse mutationer bremse nukleare import10.

Figure 1
Figur 1: skematisk fremstilling af Cdk1 in vitro- kinase assay. Venligst klik her for at se en større version af dette tal.

Figure 2
Figur 2: CENP-F er fosforyleret af Cdk1/cyclin B. (A) at identificere Cdk1 specifikke fosforylering websteder, en in vitro- kinase analyse blev udført med renset CENP-F (restprodukter fra 2,987-3,065). SDS-PAGE analyse af en negativ kontrol uden Cdk1/cyclin B er vist i venstre vognbane (-Cdk1), dernæst til in vitro- fosforyleret CENP-F i den rigtige vognbane (+ Cdk1). Molekylær vægt standarderne er indiceret. Bemærk den opadgående skift af fosforyleres CENP-F på SDS-PAGE, som er konsistent med vellykket fosforylering. Cdk1 og cyclin B vises som svage bands på 34 kDa og 60 kDa. (B) ESI-ion trap massespektrometri af intakt fosforyleres CENP-F fra (A) blev brugt til at bestemme fosfat belastning af intakt fosforyleres CENP-F (84-mer). Den tilsvarende masse spektrum er vist. Intensiteten er afbildet versus masse til ladning forhold (m/z). Spektret viser + 10 til + 14 afgift stater intakt CENP-F Fragmentets efter fosforylering. De angiver en arter befolkning med 0, 1, 2, 3 og 4 fosfat estere. For at kvantificere forholdet mellem hver art total protein beløb, tophøjder blev bestemt og sammenlignet (tabel 1). Dette tal er blevet ændret fra10 og blev gengivet med tilladelse af Taylor og Francis udgiver. Venligst klik her for at se en større version af dette tal.

Figure 3
Figur 3: funktionel kontrol: phosphomimetic mutationer af CENP-F kraftigt mindske interaktion med nukleare transport receptor karyopherin α. (En-F) Renset CENP-F fragmenter (restprodukter fra 2,987-3,065) (0,1 mg) og renset karyopherin α (0,7 mg) og blev blandet i 1:1 molar forholdet og analyseret af størrelse udstødelse kromatografi. CENP-F fragmenter og karyopherin α var også analyseres individuelt. SDS-PAGE analyse af peak fraktioner er vist. Eluering diskenheder angives i bunden (i 0,6 mL intervaller). Til venstre angives holdninger molekylvægt markør bands og deres masserne i kDa. En stjerne markerer spor af resterende GST (glutathion S-transferase). (A) Karyopherin α. (B) eluering profiler. Absorbans ved 280 nm er afbildet versus eluering volumen. Eluering profil for karyopherin α (rød) er belagt med eluering profiler af blandinger af karyopherin α med CENP-F fragmenter (wild-type: grøn, phosphomimetic S3048D mutant: blå). Bemærk, at tilsætning af wild-type CENP-F fragment skifter eluering volumen af karyopherin α peak til højere masse, som er i overensstemmelse med bindingen af CENP-F vildtype fragment. Dette skift er ikke observeret, når CENP-F fragment med phosphomimetic mutation S3048D er tilføjet, hvilket tyder på at phosphomimetic mutation høj grad mindsker samspillet mellem CENP-F og karyopherin α. (C) CENP-F vildtype fragment (wt) og karyopherin α. (D) CENP-F wt fragment. (E) CENP-F S3048D fragment og karyopherin α. (F) CENP-F S3048D fragment. Dette tal blev oprettet med data fra10. Venligst klik her for at se en større version af dette tal.

Tabel 1A. Sekvensen af CENP-F fragment (rester 2987-3065) med forudsagt Cdk1-specifikke fosforylering websteder fremhævet af større skriftstørrelse. Tryptic fragmenter er fremhævet med fed og understreget.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabel 1B. Massespektrometri analyse af intakt CENP-F
84 mer efter in vitro- fosforylering med Cdk1/cyclin B
# af fosforylering websteder (P) opdaget Fosfat belastning udtrykt i % af total protein
CENP-F 2987-3065 0P 6%
1 P 37%
2P 70F
3P 15%
4P 3%
Tabel 1C. Massespektrometri analyse af tryptic peptider af CENP-F efter in vitro- fosforylering med Cdk1/cyclin B
# af fosforylering websteder Fosfat belastning
Tryptic phosphopeptide, 0P 57%
restkoncentrationer 2995-3016 1 P 43%
Tryptic phosphopeptide, 0P 7%
restkoncentrationer 3031-3052 1 P 64%
2P 29%
3P 1%

Tabel 1: Mass massespektrometri analyse af CENP-F fragment efter in vitro- fosforylering med Cdk1/cyclin B. Denne tabel blev oprettet med data fra10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Vores in vitro- kinase assay er en meget kraftfuld metode til at identificere molekylære mål for kinase Cdk1, som er en master controller af cellecyklus og regulerer mange vigtige cellulære processer. Metoden bestemmer, om et oprenset protein er et substrat for Cdk1 og giver mulighed for identificering af specifikke fosforylering websteder. Dette letter Mekanistiske undersøgelser for regulering af cellulære processer ved fosforylering gennem Cdk1.

Den mest kritiske faktor for succesfulde identifikation af fosforylering websteder af massespektrometri er fosforylering effektiviteten af kinase assay. Fosforylering effektiviteten af de enkelte steder skal være så højt som muligt, helst 100%. Dette kan opnås ved at øge mængden af Cdk1/cyclin B og øge inkubationstiden til 16 h. Ved beregningen af Cdk1/cyclin B behov, den molære koncentration af protein og antallet af fosforylering websteder bør overvejes. Dette er især vigtigt hvis flere fosforylering websteder er til stede i target proteinet. Det skal også bemærkes, at aktiviteten af kommercielle Cdk1/cyclin B kan variere fra batch til batch, og at kinase kan miste aktivitet hurtigt. Hvis i vitro fosforylering er mislykket, anbefales det at teste kinase aktivitet. Som positiv kontrol til fejlfinding, kan in vitro- fosforylering af CENP-F (restprodukter fra 2,987-3,065) bruges. Som en negativ kontrol, en reaktion uden Cdk1/cyclin B tilsætning udført og analyseret. En anden nyttig negativ kontrol er brugen af en kinase-døde mutant af Cdk1, som er katalytisk inaktive, på grund af en simpel punkt mutation (D146N)47,48,49. Derudover for at bekræfte websteder, identificerede fosforylering, kan en phosphonegative version af target proteinet oprettes, hvor fosforylering websteder erstattes af alanines. Hvis de identificerede fosforylering sites er korrekte, kan de tilsvarende phosphonegative mutant fosforyleres in vitro.

Et simpelt værktøj til at detektere vellykket fosforylering af target proteinet er den simple SDS-PAGE gel Skift assay beskrevet her. Fosforyleres proteiner typisk migrere langsommere på SDS-PAGE end deres unphosphorylated kolleger, på grund af den ekstra størrelse og negative afgifter. Bemærk, at for store proteiner, optimering af SDS-PAGE analyse er forpligtet til at forbedre beslutning tilstrækkeligt til at visualisere gel Skift. Et nyttigt redskab for den specifikke adskillelse af fosforyleres proteiner er fosfat-bindende tag (billederne-tag) SDS-PAGE. Fosforyleres proteiner i en gel, tilberedt med billederne-tag acrylamid er visualiseret som langsommere overflytter bands sammenlignet med tilsvarende defosforyleret proteiner50,51.

For at opnå høj kvalitet massespektre, er det meget vigtigt, at protein til in vitro- kinase assay er ren og homogen. Vores rensning protokol opnår dette ved at kombinere flere yderst selektiv kromatografi trin og ved at forhindre protein nedbrydning og oxidation gennem tilsætning af proteasehæmmere og reduktionsmidler. Rensning-protokollen kan ændres for at eluere protein af glutathion (dvs.med GST-tag intakt); Det bør imidlertid overvejes, at GST-tag tilføjer en anden 25 kDa, og store proteiner udfordrende mål for massespektrometri. Alternativt, vores rensning protokol for hans6-tag fusion proteiner kan også bruges.

Denne protokol kan også ændres for at identificere fosforylering websteder, der er specifikke for andre kinaser. Det eneste krav er, at den rensede kinase er ledige, aktive og tilstrækkeligt stabil. Assay betingelser skal være justeret for hver kinase at opnå maksimal aktivitet. Parametre for at optimere omfatter størrelsen af kinase, reaktion buffer (pH, saltkoncentration), inkubationstiden, reaktion temperatur og ATP koncentrationen. In vitro kinase assays har held været anvendt til at identificere fosforylering websteder for mange kinaser herunder Plks (polo-lignende kinaser)52,53,54, og MAPK/ERK kinaser (mitogen-aktiveret protein kinaser / ekstracellulær signal-reguleret kinaser)55,56.

Mens styrken af denne metode er at identificere specifikke fosforylering websteder i et oprenset protein, skal det bemærkes, at en fosforylering websted, der er et mål for Cdk1 in vitro ikke nødvendigvis kan fosforyleres in vivo. I vivo, yderligere lovgivningsmæssige mekanismer er på plads, der kunne gøre en fosforylering site utilgængelige for anerkendelse af Cdk1. For eksempel kan ekstra interaktion partnere være til stede i vivo, hvilke kunne skjule en fosforylering websted eller gøre det tilgængeligt gennem strukturelle ændringer. Desuden skal underlaget colocalize med Cdk1/cyclin B i kernen i G2 fase for at blive fosforyleret. Derudover kan posttranslationelle modifikationer eller andre regulerende processer påvirke kropsbygning af target protein i vivo, der kunne gøre en fosforylering site utilgængelige. Disse begrænsninger kan overvindes ved at designe passende eksperimenter i celler eller dyremodeller, der Kontroller, at de identificerede fosforylering websteder har en fysiologisk funktion. Her bruger vi en enkel bindende assay for funktionel kontrol, da fosforylering mindsker samspillet mellem CENP-F og karyopherin α. funktionel kontrol også skal udføres i forbindelse med celler eller en dyremodel. Derfor, vi også transfekteret fluorescerende fusion proteiner i CENP-F-fragmenter, der indeholdt cNLS i HeLa celler10. Phosphomimetic mutationer i cNLS af CENP-F formindsket nukleare lokalisering, som bekræftede en fysiologisk funktion af disse fosforylering sites10.

Flere værktøjer er tilgængelige for funktionel kontrol af fosforylering websteder i celler eller dyremodeller. Phosphomimetic mutationer, som efterligner virkningen af fosforylering af negative afgifter, er almindeligt brugt til dette formål. For disse, er webstedet fosforylering (Serin eller Threonin) erstattet af aspartat eller glutamat. Fordelen er, at kun punkt mutation af target proteinet er påkrævet. Det skal bemærkes, at mens phosphomimetic mutationer blev med succes anvendt i mange tilfælde for funktionel kontrol, de især arbejder i tilfælde, hvor afgift ændringer er den fremherskende bidragyder til forordning i stedet for en strukturel ændring. Phosphomimetic mutationer undlader at efterligne virkningerne af fosforylering i mange andre tilfælde (f.eks., 11). Men andre tilgange er tilgængelige for funktionel kontrol af fosforylering websteder, herunder brugen af phosphonegative mutationer: disse mutationer forhindre fosforylering af erstatter fosforylering websteder med alanin. En anden nyttig tilgang til funktionel kontrol i cellulære sammenhæng er udtryk for en kinase-døde mutant af Cdk1, som er inaktiveret ved en let at indføre punkt mutation (D146N)47,48,49. Navnlig, er flere små molekyle Cdk1 hæmmere kommercielt tilgængelige som Flavopiridol og RO-3306, som kan bruges til funktionelle undersøgelser enten i celler eller dyremodeller7,8,11. Disse inhibitorer er godt præget, og flere er i kliniske forsøg til behandling af cancer (for en anmeldelse Se9).

Mens et stort antal protein fosforylering sites er blevet identificeret i proteom undersøgelser, kinase specificitet er oftest ukendt, og in vitro- kinase assay er en af de få metoder for at identificere substrater af Cdk1. Andre metoder har også været brugt. Cdk1 mål blev identificeret ved hjælp af en manipuleret Cdk1 enzym. Det har en større substrat bindende lomme og accepterer mere omfangsrig versioner af ATP som et substrat6. Denne voluminøse substrat kan ikke binde til vildtype kinaser. Tilsætning af radiolabeled pladskrævende ATP til en celle, ekstrakt, der indeholder den modificerede Cdk1 enzym fører derfor til den specifikke mærkning af de direkte substrater af Cdk1. 200 Cdk1 mål var identificeret i spirende gær med denne metode; men det kan ikke anvendes til pattedyrceller, hvilket er en afgørende begrænsning. I en anden undersøgelse, blev Cdk1 substrater identificeret i menneskelige vævskultur celler ved at udføre kvantitative fosfoproteomanalyse analyse ved hjælp af to små molekyle hæmmere af Cdk1, Flavopiridol og RO-3306. 1215 phosphopeptides på 551 proteiner blev væsentligt reduceret efter Cdk1 hæmmer desuden7. Denne metode kan skærmen en hel proteomet for potentielle Cdk1 mål, men der følger mål skal verificeres, fxved en in vitro- kinase assay.

In vitro- kinase analysen vil i fremtiden sandsynligvis kombineres med høj overførselshastighed skærme for Cdk1 substrater, der er i øjeblikket under udvikling. På grund af det store antal Cdk1 substrater i proteomet, mange menneskelige Cdk1 substrater fortsat skal være identificeret, og in vitro- kinase analysen vil være et vigtigt redskab til at identificere, kort og bekræfte disse websteder.

In vitro- kinase assay er et kraftfuldt værktøj til at identificere mål for kinase Cdk1 og identificere specifikke fosforylering websteder. Identifikation af disse fosforylering websteder gør det Mekanistiske undersøgelser til regulering af cellulære processer af Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Forfatterne har ikke noget at oplyse.

Acknowledgments

Vi takker Dr. David King, Howard Hughes Medical Institute, University of California i Berkeley for massespektrometri analyse og nyttige kommentarer. Vi takker Dr. Xuelian Zhu, Shanghai, institutter for biologiske videnskaber, kinesiske Academy of Sciences, Shanghai, Kina for at give en fuld-længde CENP-F-konstruktion. Endelig, vi takker Dr. Susan Bane, Dr. Brian Callahan og Dr. Christof Grewer på Binghamton Universitet for adgang til udstyr. Denne forskning blev finansieret af instituttets forskning for State University of New York og Institut for kemi, State University of New York på Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identifikation af Cyclin-afhængig Kinase 1 specifikke fosforylering websteder ved en <em>In Vitro</em> -Kinase Assay
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter