Een abonnement op JoVE is vereist om deze inhoud te bekijken. Log in of start vandaag met uw gratis proefperiode.

Methodenartikel

An In Vitro Method to Identify Innate and Adaptive Immune Cells Residing in Murine Lungs

907 weergaven

⸱

8 juli 2025

In dit artikel

Samenvatting

Source: Christofides, A., et al. Flow Cytometric Analysis for Identification of the Innate and Adaptive Immune Cells of Murine Lung. J. Vis. Exp. (2021).

This video demonstrates an in vitro technique to identify immune cells residing in murine lungs. After isolating target immune cells from murine lung tissue, they are surface-labeled using a cocktail of fluorophore-tagged antibodies against specific markers on innate and adaptive immune cells. Additionally, monocytes, macrophages, and dendritic cells are labeled using an intracellular marker. The various immune cell types are then identified using flow cytometry.

Protocol

All procedures involving animal models have been reviewed by the local institutional animal care committee and the JoVE veterinary review board.

1. Surgical excision and tissue preparation

  1. Euthanize the mouse by intraperitoneally injecting 1 mL of tribromoethanol (prepared according to standard protocol; Table of Materials).
    NOTE: CO2 asphyxiation should be avoided in lung studies as it might cause lung injury and alter the features and properties of lung immune cells. Cervical dislocation should also be avoided as it might cause mechanical injury of the lung.
  2. Transfer the mouse to a clean and dedicated area for surgical operation.
  3. Stabilize the mouse dorsal side down by using needles or tape on the four extremities. Use 70% ethanol to sanitize the skin of the ventral area.
  4. Perform an incision in the skin, from the neck to the abdomen. Carefully remove the skin from the thoracic area.
  5. Carefully remove the sternum and ribs.
  6. Flush the lungs by injecting 10 mL of cold phosphate-buffered saline (PBS) directly in the right ventricle, using an 18-21 G needle, until the lungs become completely white.
  7. Carefully remove the thymus and heart without touching the lungs.
  8. Gently detach the lungs from the surrounding tissues and transfer them to a tube with cold bovine serum albumin (BSA) buffer (Table 1).
    NOTE: Effort should be made to remove all adjacent fat from the lungs before further preparing the single-cell suspension, as this could bias the readouts.

2. Preparation of single-cell suspension

  1. Transfer the lungs to an empty Petri dish and mince them with two fine scalpels. Transfer all the pieces of the minced lung to a new 50 mL conical tube. Use 5 mL of digestion buffer to wash the plate and add it to the 50 mL tube containing the minced lung (Table 1).
    NOTE: Digestion buffer should be prepared immediately before use. Use 5 mg/mL of collagenase. Combining 1 or 5 mg of collagenase with BSA buffer or protein-free PBS did not improve results (Figure 1).
  2. Secure the lid of the tube and digest the lung for 30 min on an orbital shaker at a speed of 150 rpm at 37 °C. Stop the reaction by adding 10 mL of cold BSA buffer.
  3. After digestion, use an 18 G needle to mix and dissolve the lung pieces. Place a 70 µm filter strainer at the top of a new 50 mL conical tube.
    NOTE: Usage of a smaller micron filter might result in the loss of major myeloid populations.
  4. Slowly transfer the digested lung mixture directly on the strainer. Use the rubber side of a 10 mL syringe plunger to smash the remaining lung pieces on the filter. Wash the processed material on the filter with BSA buffer.
  5. Centrifuge the single-cell suspension at 350 × g for 8 min at 4 °C.
  6. Carefully discard the supernatant and resuspend the cells in 1 mL of ammonium–chloride–potassium (ACK) lysis buffer. Mix well using a 1 mL pipet, and incubate for 90 s at room temperature.
  7. Add 10 mL of cold BSA buffer to stop the reaction and centrifuge at 350 × g for 7 min at 4 °C.Carefully discard the supernatant and resuspend the pellet in Staining Buffer to count the cells using a hemocytometer.
  8. Resuspend the cells at a concentration of 5 × 106 cells/mL and use them for surface staining (see section 2).
    NOTE: For this purpose, plate the cells in a 96-well round-bottom plate followed by antibody staining and washes. If a plate centrifuge is not available, use flow tubes instead of plates. With this protocol, ~15-20 × 106 cells per lung can be obtained from a 6-10-week-old C57BL/6 mouse of average size.

3. Surface antibody staining

  1. Transfer 1 × 106 cells in 200 µL per well in a 96-well plate. Centrifuge the plate at 350 × g for 7 min at 4 °C. In the meantime, prepare the Fc-block solution by diluting anti-16/32 antibody (1:100) in staining buffer (Table 1).
  2. Resuspend the cells in 50 µL of the pre-prepared Fc-blocking solution (Table of Materials) and incubate for 15-20 min at 4 °C or on ice.
  3. Add 150 µL of staining buffer and centrifuge the plate at 350 × g for 5 min at 4 °C. Meanwhile, prepare the surface antibody cocktail by diluting surface antibodies (1:100; Table 2) in staining buffer.
    NOTE: (i) Anti-16/32 antibody for Fc-blocking can be used with the surface antibodies in the same mixture. (ii) If fixable viability dye is used, add it to the surface antibody cocktail at a dilution of 1:1,000.
  4. Resuspend the cells in 50 µL of the pre-prepared surface antibody cocktail and incubate for 30-40 min at 4 °C in the dark. Wash the cells with staining buffer twice.
    ​NOTE: If no intracellular staining is required, resuspend the cells in 200 µL of staining buffer and proceed directly to the acquisition of data on the flow cytometer. Alternatively, cells might be fixed and stored at 4 °C for acquisition later. We recommend using the cells for flow cytometry within 24 h.

4. Cell fixation and intracellular staining

  1. Prepare the fixation/permeabilization buffer (Fix/Perm Buffer) by mixing three parts of fixation/permeabilization concentrate and 1 part of fixation/permeabilization diluent of the FoxP3/Transcription Factor Staining Buffer Set (Table 1).
  2. Resuspend the cells in 50 µL of the pre-prepared Fix/Perm Buffer per well of the 96-well plate, where cells were plated as described in section 3, and incubate them for 20-25 min at 4 °C in the dark.
  3. Dilute the 10x permeabilization buffer as 1: 10 in purified deionized water to prepare 1x permeabilization buffer.
  4. Wash the cells once with 1x permeabilization buffer. Meanwhile, prepare the intracellular antibody cocktail by diluting intracellular antibodies (1:100) in 1 mL of permeabilization buffer.
  5. Resuspend the cells using 50 µL of the pre-prepared surface antibody cocktail per cell of the 96-well plate and incubate for 40 min at 4 °C in the dark.
  6. Wash the cells once with permeabilization buffer and once with staining buffer. After the final wash, resuspend the cells in 200 µL of staining buffer.
    NOTE: If no flow cytometer with plate reader is available, transfer the cells into flow cytometry tubes.
  7. Acquire a minimum of 1.5 × 106 cells per sample on the flow cytometer.
    NOTE: For single colors and unstained control samples, 0.5-1 × 106 cells per sample will be sufficient. It is recommended to titer the individual antibodies used to achieve optimal staining and reduce costs. The present protocol has been optimized using Fix/Perm Buffer prepared using the FoxP3 staining buffer set. Because CD68 is a cytoplasmic and not a nuclear marker, other permeabilization solutions such as a low concentration of paraformaldehyde or cytofix/ cytoperm kits from various vendors might be sufficient.

Table 1: Buffers.

BSA bufferPBS + 0.5% Bovine serum albumin
Digestion bufferPrewarmed (37 °C) BSA buffer + 5 mg/mL collagenase type 1 + 0.2 mg/mL DNase I
Staining bufferPBS + 2.5% FBS
Fix/Perm BufferThree parts of fixation/permeabilization diluent and 1 part of fixation/permeabilization diluent of the Foxp3/Transcription Factor Staining Buffer Set
Permeabilization buffer10x permeabilization buffer from the Foxp3/Transcription Factor staining Buffer Set diluted 10 times in purified deionized water

Table 2: Usage of monoclonal antibodies.

AntigenCloneFluorochromeDilutionSurface/intracellular
CD4530-F11APC/CY71:100surface
Gr-1RB6-8C5BV4211:100surface
CD68FA-11PerCPCy5.51:100intracellular
CD11bM1/70PECy71:100surface
Siglec FS17007LFITC1:100surface
CD11cN418BV650 or BV5101:100surface
CD64X54-5/7.1PE/Dazzle 5941:100surface
MHC-IIM5/114.15.2AF7001:100surface
CD1032.00E+07PE / FITC1:100surface
Live/Dead Fixable Far Read Dead Cell Stain KitFarRed (APC) or Aqua (BV510)1:1000surface
CD317A2PE1:100surface
B220RA3-6B2AF4881:100surface
NK1.1PK136FITC1:100surface
CD2430-F1PE1:100surface
MERTK2B10C42PE1:100surface
F4/80BM8BV6051:100surface
CX3CR1SA011F11PE1:100surface
FcBlock (CD16/32)931:100surface

Toegang beperkt. Log in of start een proefperiode om deze inhoud te bekijken.

Resultaten

Flow cytometry gating strategy; diagrams show cell population differentiation via CD markers in leukocytes.
Figure 1: The best cellular dissociation is achieved by 5 mg/mL of collagenase 1 in prewarmed PBS + 0.5% BSA. In all different conditions, 0.2 mg of DNAse I was also included. Abbreviations: BSA = bovine serum albumin; FSC-A = peak area of forwar...

Toegang beperkt. Log in of start een proefperiode om deze inhoud te bekijken.

Openbaarmakingen

No conflicts of interest declared.

Materialen

Lijst van materialen gebruikt in dit artikel
NaamBedrijfCatalogusnummerOpmerkingen
10 mL syringe plungerEXELINT26265
18 G needlesBD Precision Glide Needle305165
21 G needlesBD Precision Glide Needle305195
50 mL conical tubesFalcon3520
70 μm cell strainerThermoFisher22363548
96-well platesFalcon/corning3799
ACK Lysing BufferThermoFisherA10492-01
anti-mouse CD11bBiolegend101215For details see Table 2
anti-mouse CD11cBiolegend117339 / 117337For details see Table 2
anti-mouse CD45Biolegend103115For details see Table 2
anti-mouse CD64Biolegend139319For details see Table 2
anti-mouse CD68Biolegend137009For details see Table 2
anti-mouse GR-1Biolegend108433For details see Table 2
anti-mouse Siglec FBiolegend155503For details see Table 2
AVERTINSigma-Aldrich240486
B220Biolegend103228For details see Table 2
Bovine Serum Albumin (BSA)Sigma-Aldrich9048-46-8
CD103Biolegend121405 / 121419For details see Table 2
CD24Biolegend138503For details see Table 2
CD3Biolegend100205For details see Table 2
Centrifuge
Collagenase Type 1Worthington Biochemical CorpLS004196
CX3CR1Biolegend149005For details see Table 2
DNase IMillipore Sigma10104159001
Ethanol
F4/80Biolegend123133For details see Table 2
FcBlock (CD16/32)Biolegend101301For details see Table 2
Fetal Bovine SerumR&D Systems
Fine Serrated ForcepsRoboz Surgical Instrument Co
Foxp3 / Transcription Factor Staining Buffer SetThermoFisher00-5523-00
Futura Safety ScalpelMerit Medical SystemsSMS210
Live/Dead Fixable Far Read Dead Cell Stain KitThermoFisherL34973For details see Table 2
MERTKBiolegend151505For details see Table 2
MHC-IIBiolegend107621For details see Table 2
NK1.1Biolegend108705For details see Table 2
Orbital ShakerVWRModel 200
Petri dishFalcon351029
Refrigerated benchtop centrifugeSORVAL ST 16R
Small curved scissorRoboz Surgical Instrument Co

Tags

Immuuncellen uit de long van muizenflowcytometrie-analyseweefseldigestieprotocolcelisolatietechniekFc-receptorblokkeringoppervlaktemarker-kleuringintracellulaire markerlabelingclassificatie van immuuncellenACK-lysebufferBSA-bufferwassing