Detection of Detergent-sensitive Interactions Between Membrane Proteins

Summary

We describe a protocol for detection of detergent-sensitive interactions between membrane proteins using binding of the sorting receptor, sortilin, to the first luminal loop of the glucose transporter protein, GLUT4, as an example.

Abstract

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein interactions in many cases is associated with significant experimental challenges. In particular, sorting receptors interact with their protein cargo in the lumen of the membrane compartments often in a detergent-sensitive fashion, making co-immunoprecipitation of these proteins unusable. Binding of the sorting receptor sortilin to glucose transporter GLUT4 may serve as an example of weak luminal interactions between membrane proteins. Here, we describe a fast, simple, and inexpensive assay to validate the interaction between sortilin and GLUT4. For that, we have designed and chemically synthesized the myc-tagged peptide corresponding to the potential sortilin-binding epitope in the luminal part of GLUT4. Sortilin tagged with six histidines was expressed in mammalian cells, and isolated from cell lysates using Cobalt beads. Sortilin immobilized on the beads was incubated with the peptide solution at different pH values, and the eluted material was analyzed by Western blotting. This assay can be easily adapted to study other detergent-sensitive protein-protein interactions.

Introduction

GLUT4 is a glucose transporter protein which is expressed predominantly in fat and skeletal muscle cells where it mediates the effect of insulin on post-prandial blood glucose clearance¹. Being a very stable protein, GLUT4 is regulated at a post-translational level. In the absence of insulin, GLUT4 is largely excluded from the plasma membrane (hence low basal permeability for glucose) and is localized mainly inside the cell in small insulin-responsive vesicles (IRVs) and trans-Golgi network (TGN) that is likely to represent the IRV donor compartment. Upon insulin administration, the IRVs fuse with the plasma membrane and deliver GLUT4 to the site of its functioning. This increases the permeability of the plasma membrane for glucose, so that glucose uptake from blood into adipocytes and skeletal myocytes rises 10 to 40-fold. After insulin withdrawal, GLUT4 is internalized into early/sorting endosomes and then retrieved to TGN where the IRVs are re-formed. Both sorting steps in the GLUT4 pathway, i.e. retrieval from the peripheral early endosomes to the perinuclear TGN, and the formation of the IRVs on the TGN donor membranes are enabled by the Vps10p family member, sortilin, which represents a type I transmembrane protein and a sorting receptor. According to one model, sortilin works as a transmembrane scaffold protein: it binds GLUT4 in the lumen of endosomes and TGN, and recruits retromer or clathrin adaptors to the cytoplasmic side of the donor membrane via its C-terminus^2,3. This facilitates the distribution of GLUT4 into vesicular carriers that translocate GLUT4 between intracellular compartments.

The interaction of the cytoplasmic tail of sortilin with retromer and various adaptor proteins has been well documented. However, the binding of sortilin to GLUT4 (and to several of its other protein ligands) has been challenging to prove. In particular, attempts to co-immunoprecipitate sortilin and GLUT4 have not been successful probably due to the detergent-sensitive nature of the interaction between these two proteins. In addition, as a typical transporter protein, GLUT4 has 12 transmembrane domains and 6 luminal loops any combination of which may potentially represent a sortilin-binding site. At the same time, a large body of indirect evidence, such as substantial co-localization in the cell, cross-linking with membrane-permeable DSP, and the interaction in yeast two hybrid system suggest that sortilin can bind to GLUT4. Furthermore, using the latter approach in a combination with the alanine scanning mutagenesis, we have previously determined that the Vps10p domain of sortilin binds primarily to the first luminal loop of GLUT4. However, the proof of such an interaction in mammalian cells has been missing. Here, we have isolated His-tagged sortilin from transfected 3T3-L1 cells using cobalt resin and demonstrated that it can interact with chemically synthesized peptide corresponding to the first luminal loop of GLUT4 at pH 6 and pH 8 that resemble acidic milieu in the endosomal lumen and neutral environment in the lumen of the TGN membranes. No peptide binding was detected in control experiments where extract prepared from non-transfected cells was loaded on the same beads.

Protocol

1. Handling of the Peptide

1. Design and ordering of the peptide
   1. Choose the desired sequence of the peptide, and add a tag, such as myc epitope (EQKLISEED) at its either N- or C-terminus.
   2. Check the predicted solubility of the peptide in water, using peptide solubility calculator http://pepcalc.com/peptide-solubility-calculator.php. If the solubility is low, try to add another water-soluble tag to change the charge balance.
      NOTE: We used the peptide corresponding to the first luminal loop (fll) of GLUT4 tagged with the myc epitope (bold font) at the N terminus (Myc-fll-GLUT4): EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA that has "good" predicted solubility in water.
   3. Order the custom peptide with at least 75% purity which is sufficient for the assay, and ask the provider for solubility test. Separate the order into at least two aliquots in case of unforeseen problems with dissolving the peptide.
      NOTE: Myc-fll-GLUT4 was ordered in two aliquots. Its reported solubility in ultrapure water is ≤10 mg/mL.
2. Dissolving the peptide
   Note: Ultrapure water is the best solvent. If the peptide does not appear to be water soluble, refer to http://www.genscript.com/peptide_solubility_and_stablity.html for instructions.
   1. Prepare 100x working solution of the peptide in ultrapure water or in buffer of choice, with the concentration of 100 μg/mL.
   2. Separate the solution into 50 - 100 µL aliquots, and store them at -20 °C.

2. Handling of Cells

1. Cell culture
   1. Use Wild type (WT) cells as a negative control, and cells expressing the target protein tagged with six histidines (HisP).
      NOTE: We used 3T3 L1 pre-adipocytes stably transfected with Sortilin-myc/His⁵.
   2. Grow the cells in Dulbecco's Modified Eagle Medium (DMEM) high Sugar, supplemented with 10% calf bovine serum, glutamine (2 mM) and penicillin/streptomycin (5 μg/mL) at 37 °C in 10% CO₂.
   3. Sit four 10 cm dishes of cells, transfect two of them with HisP and transfect the other two with control plasmid (WT). 48 h after transfection, cells should reach 80 - 90% confluency.
2. Preparation of the Cell Lysates
   1. Prepare lysis buffer (10 mM Hepes, 30 mM NaCl, 5% glycerol, 10 mM Imidazole, 0.5% Triton X-100 and protease inhibitor cocktail without EDTA for the isolation of His-tagged proteins, pH 7.4) and keep it at 4 °C:
   2. Wash cells three times with 10 mL of 1x phosphate-buffered saline (PBS) at 4 °C.
   3. Put the dishes on ice and add 500 µL of lysis buffer to each dish. Harvest the cell lysates using a cell scraper.
   4. Place the cell lysate from each dish into a different 1.5 mL tube. Label the tubes as WT-pH6, WT-pH8, HisP-pH6, HisP-pH8.
   5. Pass the cell lysates through a syringe with a 26G needle five times up and down, to complete lysis.
   6. Centrifuge the cell lysates at 16,000 x g for 10 min at 4 °C.
   7. Transfer the supernatants to new identically labeled tubes.
   8. Analyze protein concentration using the BCA Protein Assay Kit or other kit.
   9. Using lysis buffer, equalize protein concentration of all four lysates.
   10. Separate a small (ca. 20 µL) aliquot of each lysate and keep it at -20 °C for possible control experiments and/or trouble shooting.

3. Binding of His-tagged Proteins to the HisPur Cobalt Beads

1. Use commercially available wash buffer or prepare one (50 mM Na₂HPO₄/NaH₂PO₄, 300 mM NaCl, 20 mM imidazole, pH 8) and keep it at 4 °C.
2. Prepare wash buffer with pH 6 by tittering wash buffer pH 8 with HCl. Keep it at 4 °C.
3. Gently swirl the bottle of the cobalt beads to make homogenous suspension.
4. Dispense 40 µL of the Cobalt beads suspension into four 1.5 mL tubes marked as above (step 2.2.4).
5. Add 1 mL of lysis buffer to each tube, and centrifuge the tubes at 1000 x g for 5 s. Aspirate the supernatant, and add 40 μL of lysis buffer to settled beads.
6. Add the cell lysates to corresponding tubes.
7. Incubate the tubes for 90 min at 4 °C on a tube rotator at 20 rpm.
8. Centrifuge the tubes at 1000 x g for 5 s and collect the supernatant. Keep the supernatant at 4 °C.
9. Add 500 µL of either pH 8 or pH 6 wash buffer to corresponding tubes and re-suspend the beads gently.
10. Centrifuge the tubes at 1000 x g for 5 s and discard the supernatants.
11. Repeat steps 3.9 and 3.10 for four times.

4. Binding of the Peptide to the His-tagged Protein Immobilized on the Beads

1. Using 100x working solution of the peptide (step 1.2.1), prepare 1x working solutions in either pH 6 or pH 8 wash buffer (two 100 µL aliquots for each, 1 µg/mL).
2. Add 100 μL of 1x peptide solution to the washed beads with the corresponding pH.
3. Incubate the beads for 30 min at 4 °C on a tube rotator at 20 rpm.
4. Centrifuge the tubes at 1,000 x g for 5 s, collect the supernatant and keep it at -20 °C.
5. Repeat steps 3.9 and 3.10 for four times.
   NOTE: In order to decrease possible background, the following steps could replace steps 4.4 & 4.5.
6. Take four micro columns with 30 μm pores, label them as in step 2.2.4, and place the columns in collection tubes.
7. After completion of step 4.3, transfer the incubation mixture into the columns, allow the solution to pass through by gravity. Keep the flow through at -20 °C.
8. Pass 500 µL of wash buffer with pH 6 or pH 8 through corresponding columns by gravity. Discard the flow through.
9. Repeat step 4.8 four times.
10. After the last wash, centrifuge the columns at 1,000 x g for 15 s.

5. Elution from Cobalt Beads

1. Use commercial Tricine sample buffer (200 mM Tris-HCl, 40% glycerol, 2% SDS, 0.04% Coomassie Blue, pH 6.8) and add β-mercaptoethanol to the final concentration of 2%.
2. Add 40 µL of Tricine sample buffer (with β-mercaptoethanol) to the washed beads and vortex the sample.
3. Heat the samples for 10 min at 100 °C, vortex the samples again, and centrifuge the tubes at 1,000 x g for 5 s.
   NOTE: In order to decrease possible nonspecific binding in the elution, the following steps could replace steps 5.1 - 5.3.
4. Add 40 μL of Elution Imidazole Buffer (50 mM Na₂HPO₄/NaH₂PO₄, 300 mM NaCl, 0.25 M imidazole) to the washed beads, vortex and incubate the tubes at room temperature for 20 min.
5. Centrifuge the tubes at 3,000 x g for 30 s, collect the supernatant (eluted samples) and transfer it to new labeled tubes.
6. Add 40 μL of Tricine sample buffer to each tube, heat the samples for 10 min at 100 °C, vortex and centrifuge the tubes at 1,000 x g for 5 s.
   NOTE: If micro columns are used, add the elution buffer to the washed beads, incubate for 20 min and collect the elution by centrifugation at 8,000 x g for 2 min.
   NOTE: Samples can be kept at -20 °C till electrophoresis is performed.

6. Electrophoresis and Western blotting

Note: The samples are ready for the separation by SDS-PAGE and subsequent Western blotting. Follow protocol of gel electrophoresis (https://www.jove.com/science-education/5065/the-western-blot) with the following modifications.

1. Use commercially available 10 - 20% Tricine gradient gels.
2. On the gel, load 20 µL of the eluted samples and 20 µL of lysates (step 2.2.10). For trouble shooting, it is recommended to load 20 µL of unbound material (step 3.8) and 10 ng of the peptide; before loading, add equal amount of Tricine sample buffer to these samples.
3. Carry out electrophoresis in commercial Tris/Tricine/SDS running buffer (100 mM Tris, 100 mM Tricine, and 0.1% SDS, pH 8.3).
4. Transfer the material from the gel onto a 0.45 µm nitrocellulose membrane using transfer buffer (25 mM Tris base, 192 mM glycine, pH 8.4) supplemented with 20% methanol.
5. Block the membrane with 3% Bovine Serum Albumin (BSA) for 1 h at room temperature. Using pre-stained molecular weight markers as guides, cut the membrane horizontally, blot the top part with an antibody against HisP, and blot the bottom part with an antibody against the myc epitope to identify the myc-tagged peptide.
   NOTE: In our particular case, cutting of the membrane is not required since both HisP and Myc-fll-GLUT4 can be detected with an anti-myc antibody.

7. Analysis of Results

1. Quantify the intensity of all Western blot signals using an Image Station or ImageJ program.
2. Normalize the signal from the myc-tagged peptide against the signal from HisP at both pH values.

Results

Lysates were prepared from 3T3 L1 cells stably transfected with Sortilin-myc/His⁵ and from WT 3T3 L1 cells, used as a negative control. Both lysates were incubated with cobalt beads at pH 6 or pH 8 and thoroughly washed. Beads with immobilized proteins were then incubated in the solution of Myc-fll-Glut4. After careful washes, proteins bound to the beads were eluted with 0.25 M Imidazole. Samples were subjected, along with the original lysates, to SDS-PAGE in a 10-...

Discussion

Sortilin is an evolutionary conserved multi-ligand protein receptor that is involved in both signaling at the plasma membrane and in intracellular sorting events^6,7. However, the search for the authentic sortilin's ligands (some of which are luminal or integral membrane proteins) is complicated as the interaction of sortilin with some of its binding partners appears to be sensitive to detergents. Therefore, an easy and a widespread approach for studying prote...

Materials

List of materials used in this article

Name	Company	Catalog Number	Comments
Protease inhibitor cocktail	Sigma	P8849	for use in purification of histidine tag protein
Phosphate-Buffered Saline	Corning	21-040-CV	PBS
1mL Insulin Syringe U-100	BD	329652	26G x 1/2
BCA Protein Assay Kit	Pierce	23228
Wash buffer	Boston BioProducts	BP-234	For His-tag protein purification
HisPur Cobalt Resin	Thermo Scientific	89964
Tricine sample Buffer	Bio-Rad	161-0739	with SDS, bMercaptaethanol should be added
Elution  Buffer	Boston BioProducts	BP-236	For His-tag protein purificationwith 250mM Imidazole
Mini-Protean Tris-Tricine precast gels 10-20%	Bio-Rad	456-3115	For seperation of peptide and small protein
Tris/Tricine/SDS running buffer	Bio-Rad	161-0744
Transfer Buffer	Boston BioProducts	BP-190	Add 20% methanol
Nitrocellulose membrane  0.45 mm	Bio-Rad	1620115
Bovine Serum Albumin	Sigma	A9647	BSA
Anti Myc antibody	Cell Signaling	2272	Rabbit
Peptide	Genscipt		customize ordering
Precision Plus Protein Dual color Standarts	BioRad	161-0374