Name: Detection of Detergent-sensitive Interactions Between Membrane Proteins (Video) | JoVE Journal
Uploaded: 2018-03-07T14:45:00.000+00:00
Duration: 10 min 9 s
Description: Learn to detect detergent-sensitive interactions between membrane proteins using histidine and myc tagging techniques. This fast protocol enables study of weak protein interactions in biochemistry research.

ai_agent_IP

ai_agent

maintenance

instantTrialDurationMinutes

isBiopharma

enableNewMyJoveSectionDesign

educationFeatures

seoMetaApi

ai_copilot_institution_blacklist

ai_chat_institution_blacklist

freeAccessWindow

ssoRoleCapture

scheduledMaintenanceBanner

joveLabsFeatures

disable_autoplay_for_bots

extended_trial_duration

5 minutes

This work was supported by research grants DK52057 and DK107498 from the NIH to K.V.K. X.P was supported by the institutional training grant 2T32DK007201 from the NIH.

1. Handling of the Peptide
<ol>
	<li>Design and ordering of the peptide
	<ol>
		<li>Choose the desired sequence of the peptide, and add a tag, such as myc epitope (EQKLISEED) at its either N- or C-terminus.</li>
		<li>Check the predicted solubility of the peptide in water, using peptide solubility calculator http://pepcalc.com/peptide-solubility-calculator.php. If the solubility is low, try to add another water-soluble tag to change the charge balance. 
		NOTE: We used the peptide corresponding to the first luminal loop (fll) of GLUT4 tagged with the myc epitope (bold font) at the N terminus (Myc-fll-GLUT4): EQKLISEEDLNAPQKVIEQSYNATWLGRQGPGGPSSIPPGTLTTLWA that has &#34;good&#34; predicted solubility in water.</li>
		<li>Order the custom peptide with at least 75% purity which is sufficient for the assay, and ask the provider for solubility test. Separate the order into at least two aliquots in case of unforeseen problems with dissolving the peptide. 
		NOTE: Myc-fll-GLUT4 was ordered in two aliquots. Its reported solubility in ultrapure water is &#8804;10 mg/mL.</li>
	</ol>
	</li>
	<li>Dissolving the peptide 
	Note: Ultrapure water is the best solvent. If the peptide does not appear to be water soluble, refer to http://www.genscript.com/peptide_solubility_and_stablity.html for instructions.
	<ol>
		<li>Prepare 100x working solution of the peptide in ultrapure water or in buffer of choice, with the concentration of 100 &#956;g/mL.</li>
		<li>Separate the solution into 50 - 100 &#181;L aliquots, and store them at -20 &#176;C.</li>
	</ol>
	</li>
</ol>
2. Handling of Cells
<ol>
	<li>Cell culture
	<ol>
		<li>Use Wild type (WT) cells as a negative control, and cells expressing the target protein tagged with six histidines (HisP). 
		NOTE: We used 3T3 L1 pre-adipocytes stably transfected with Sortilin-myc/His5.</li>
		<li>Grow the cells in Dulbecco&#39;s Modified Eagle Medium (DMEM) high Sugar, supplemented with 10% calf bovine serum, glutamine (2 mM) and penicillin/streptomycin (5 &#956;g/mL) at 37 &#176;C in 10% CO2.</li>
		<li>Sit four 10 cm dishes of cells, transfect two of them with HisP and transfect the other two with control plasmid (WT). 48 h after transfection, cells should reach 80 - 90% confluency.</li>
	</ol>
	</li>
	<li>Preparation of the Cell Lysates
	<ol>
		<li>Prepare lysis buffer (10 mM Hepes, 30 mM NaCl, 5% glycerol, 10 mM Imidazole, 0.5% Triton X-100 and protease inhibitor cocktail without EDTA for the isolation of His-tagged proteins, pH 7.4) and keep it at 4 &#176;C:</li>
		<li>Wash cells three times with 10 mL of 1x phosphate-buffered saline (PBS) at 4 &#176;C.</li>
		<li>Put the dishes on ice and add 500 &#181;L of lysis buffer to each dish. Harvest the cell lysates using a cell scraper.</li>
		<li>Place the cell lysate from each dish into a different 1.5 mL tube. Label the tubes as WT-pH6, WT-pH8, HisP-pH6, HisP-pH8.</li>
		<li>Pass the cell lysates through a syringe with a 26G needle five times up and down, to complete lysis.</li>
		<li>Centrifuge the cell lysates at 16,000 x g for 10 min at 4 &#176;C.</li>
		<li>Transfer the supernatants to new identically labeled tubes.</li>
		<li>Analyze protein concentration using the BCA Protein Assay Kit or other kit.</li>
		<li>Using lysis buffer, equalize protein concentration of all four lysates.</li>
		<li>Separate a small (ca. 20 &#181;L) aliquot of each lysate and keep it at -20 &#176;C for possible control experiments and/or trouble shooting.</li>
	</ol>
	</li>
</ol>
3. Binding of His-tagged Proteins to the HisPur Cobalt Beads
<ol>
	<li>Use commercially available wash buffer or prepare one (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 20 mM imidazole, pH 8) and keep it at 4 &#176;C.</li>
	<li>Prepare wash buffer with pH 6 by tittering wash buffer pH 8 with HCl. Keep it at 4 &#176;C.</li>
	<li>Gently swirl the bottle of the cobalt beads to make homogenous suspension.</li>
	<li>Dispense 40 &#181;L of the Cobalt beads suspension into four 1.5 mL tubes marked as above (step 2.2.4).</li>
	<li>Add 1 mL of lysis buffer to each tube, and centrifuge the tubes at 1000 x g for 5 s. Aspirate the supernatant, and add 40 &#956;L of lysis buffer to settled beads.</li>
	<li>Add the cell lysates to corresponding tubes.</li>
	<li>Incubate the tubes for 90 min at 4 &#176;C on a tube rotator at 20 rpm.</li>
	<li>Centrifuge the tubes at 1000 x g for 5 s and collect the supernatant. Keep the supernatant at 4 &#176;C.</li>
	<li>Add 500 &#181;L of either pH 8 or pH 6 wash buffer to corresponding tubes and re-suspend the beads gently.</li>
	<li>Centrifuge the tubes at 1000 x g for 5 s and discard the supernatants.</li>
	<li>Repeat steps 3.9 and 3.10 for four times.</li>
</ol>
4. Binding of the Peptide to the His-tagged Protein Immobilized on the Beads
<ol>
	<li>Using 100x working solution of the peptide (step 1.2.1), prepare 1x working solutions in either pH 6 or pH 8 wash buffer (two 100 &#181;L aliquots for each, 1 &#181;g/mL).</li>
	<li>Add 100 &#956;L of 1x peptide solution to the washed beads with the corresponding pH.</li>
	<li>Incubate the beads for 30 min at 4 &#176;C on a tube rotator at 20 rpm.</li>
	<li>Centrifuge the tubes at 1,000 x g for 5 s, collect the supernatant and keep it at -20 &#176;C.</li>
	<li>Repeat steps 3.9 and 3.10 for four times. 
	NOTE: In order to decrease possible background, the following steps could replace steps 4.4 &#38; 4.5.</li>
	<li>Take four micro columns with 30 &#956;m pores, label them as in step 2.2.4, and place the columns in collection tubes.</li>
	<li>After completion of step 4.3, transfer the incubation mixture into the columns, allow the solution to pass through by gravity. Keep the flow through at -20 &#176;C.</li>
	<li>Pass 500 &#181;L of wash buffer with pH 6 or pH 8 through corresponding columns by gravity. Discard the flow through.</li>
	<li>Repeat step 4.8 four times.</li>
	<li>After the last wash, centrifuge the columns at 1,000 x g for 15 s.</li>
</ol>
5. Elution from Cobalt Beads
<ol>
	<li>Use commercial Tricine sample buffer (200 mM Tris-HCl, 40% glycerol, 2% SDS, 0.04% Coomassie Blue, pH 6.8) and add &#946;-mercaptoethanol to the final concentration of 2%.</li>
	<li>Add 40 &#181;L of Tricine sample buffer (with &#946;-mercaptoethanol) to the washed beads and vortex the sample.</li>
	<li>Heat the samples for 10 min at 100 &#176;C, vortex the samples again, and centrifuge the tubes at 1,000 x g for 5 s. 
	NOTE: In order to decrease possible nonspecific binding in the elution, the following steps could replace steps 5.1 - 5.3.</li>
	<li>Add 40 &#956;L of Elution Imidazole Buffer (50 mM Na2HPO4/NaH2PO4, 300 mM NaCl, 0.25 M imidazole) to the washed beads, vortex and incubate the tubes at room temperature for 20 min.</li>
	<li>Centrifuge the tubes at 3,000 x g for 30 s, collect the supernatant (eluted samples) and transfer it to new labeled tubes.</li>
	<li>Add 40 &#956;L of Tricine sample buffer to each tube, heat the samples for 10 min at 100 &#176;C, vortex and centrifuge the tubes at 1,000 x g for 5 s. 
	NOTE: If micro columns are used, add the elution buffer to the washed beads, incubate for 20 min&#160;and collect the elution by centrifugation at 8,000 x g for 2 min. 
	NOTE: Samples can be kept at -20 &#176;C till electrophoresis is performed.</li>
</ol>
6. Electrophoresis and Western blotting
Note: The samples are ready for the separation by SDS-PAGE and subsequent Western blotting. Follow protocol of gel electrophoresis (https://www.jove.com/science-education/5065/the-western-blot) with the following modifications.
<ol>
	<li>Use commercially available 10 - 20% Tricine gradient gels.</li>
	<li>On the gel, load 20 &#181;L of the eluted samples and 20 &#181;L of lysates (step 2.2.10). For trouble shooting, it is recommended to load 20 &#181;L of unbound material (step 3.8) and 10 ng of the peptide; before loading, add equal amount of Tricine sample buffer to these samples.</li>
	<li>Carry out electrophoresis in commercial Tris/Tricine/SDS running buffer (100 mM Tris, 100 mM Tricine, and 0.1% SDS, pH 8.3).</li>
	<li>Transfer the material from the gel onto a 0.45 &#181;m nitrocellulose membrane using transfer buffer (25 mM Tris base, 192 mM glycine, pH 8.4) supplemented with 20% methanol.</li>
	<li>Block the membrane with 3% Bovine Serum Albumin (BSA) for 1 h at room temperature. Using pre-stained molecular weight markers as guides, cut the membrane horizontally, blot the top part with an antibody against HisP, and blot the bottom part with an antibody against the myc epitope to identify the myc-tagged peptide. 
	NOTE: In our particular case, cutting of the membrane is not required since both HisP and Myc-fll-GLUT4 can be detected with an anti-myc antibody.</li>
</ol>
7. Analysis of Results
<ol>
	<li>Quantify the intensity of all Western blot signals using an Image Station or ImageJ program.</li>
	<li>Normalize the signal from the myc-tagged peptide against the signal from HisP at both pH values.</li>
</ol>

<ol><li>Bogan, J. S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Regulation+of+glucose+transporter+translocation+in+health+and+diabetes%5BTitle%5D)+AND+%22Annu+Rev+Biochem%22%5BJournal%5D)">Regulation of glucose transporter translocation in health and diabetes.</a> Annu Rev Biochem. 81, 507-532 (2012).</li>
<li>Kandror, K. V., Pilch, P. F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+sugar+is+sIRVed%3A+sorting+Glut4+and+its+fellow+travelers%5BTitle%5D)+AND+%22Traffic%22%5BJournal%5D)">The sugar is sIRVed: sorting Glut4 and its fellow travelers.</a> Traffic. 12 (6), 665-671 (2011).</li>
<li>Pan, X., Zaarur, N., Singh, M., Morin, P., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+and+retromer+mediate+retrograde+transport+of+Glut4+in+3T3-L1+adipocytes%5BTitle%5D)+AND+%22Mol+Biol+Cell%22%5BJournal%5D)">Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes.</a> Mol Biol Cell. 28 (12), 1667-1675 (2017).</li>
<li>Kim, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+first+luminal+loop+confers+insulin+responsiveness+to+the+glucose+transporter+4%5BTitle%5D)+AND+%22Mol+Biol+Cell%22%5BJournal%5D)">The first luminal loop confers insulin responsiveness to the glucose transporter 4.</a> Mol Biol Cell. 23 (5), 910-917 (2012).</li>
<li>Shi, J., Kandror, K. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+is+essential+and+sufficient+for+the+formation+of+Glut4-storage+vesicles+in+3T3-L1+adipocytes%5BTitle%5D)+AND+%22Dev+Cell%22%5BJournal%5D)">Sortilin is essential and sufficient for the formation of Glut4-storage vesicles in 3T3-L1 adipocytes.</a> Dev Cell. 9 (1), 99-108 (2005).</li>
<li>Coutinho, M. F., Prata, M. J., Alves, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((A+shortcut+to+the+lysosome%3A+the+mannose-6-phosphate-independent+pathway%5BTitle%5D)+AND+%22Mol+Genet+Metab%22%5BJournal%5D)">A shortcut to the lysosome: the mannose-6-phosphate-independent pathway.</a> Mol Genet Metab. 107 (3), 257-266 (2012).</li>
<li>Willnow, T. E., Petersen, C. M., Nykjaer, A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((VPS10P-domain+receptors+-+regulators+of+neuronal+viability+and+function%5BTitle%5D)+AND+%22Nat+Rev+Neurosci%22%5BJournal%5D)">VPS10P-domain receptors - regulators of neuronal viability and function.</a> Nat Rev Neurosci. 9 (12), 899-909 (2008).</li>
<li>Mazella, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+100-kDa+neurotensin+receptor+is+gp95%2Fsortilin%2C+a+non-G-protein-coupled+receptor%5BTitle%5D)+AND+%22J+Biol+Chem%22%5BJournal%5D)">The 100-kDa neurotensin receptor is gp95/sortilin, a non-G-protein-coupled receptor.</a> J Biol Chem. 273 (41), 26273-26276 (1998).</li>
<li>Ni, X., Morales, C. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((The+Lysosomal+Trafficking+of+Acid+Sphingomyelinase+is+Mediated+by+Sortilin+and+Mannose+6-phosphate+Receptor%5BTitle%5D)+AND+%22Traffic%22%5BJournal%5D)">The Lysosomal Trafficking of Acid Sphingomyelinase is Mediated by Sortilin and Mannose 6-phosphate Receptor.</a> Traffic. 7 (7), 889-902 (2006).</li>
<li>Westergaard, U. B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Functional+organization+of+the+sortilin+Vps10p+domain%5BTitle%5D)+AND+%22J+Biol+Chem%22%5BJournal%5D)">Functional organization of the sortilin Vps10p domain.</a> J Biol Chem. 279 (48), 50221-50229 (2004).</li>
<li>Nykjaer, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/pubmed?term=((Sortilin+is+essential+for+proNGF-induced+neuronal+cell+death%5BTitle%5D)+AND+%22Nature%22%5BJournal%5D)">Sortilin is essential for proNGF-induced neuronal cell death.</a> Nature. 427 (6977), 843-848 (2004).</li>
</ol>

The authors have nothing to disclose.

Sortilin is an evolutionary conserved multi-ligand protein receptor that is involved in both signaling at the plasma membrane and in intracellular sorting events6,7. However, the search for the authentic sortilin&#39;s ligands (some of which are luminal or integral membrane proteins) is complicated as the interaction of sortilin with some of its binding partners appears to be sensitive to detergents. Therefore, an easy and a widespread approach for studying prote...

GLUT4 is a glucose transporter protein which is expressed predominantly in fat and skeletal muscle cells where it mediates the effect of insulin on post-prandial blood glucose clearance1. Being a very stable protein, GLUT4 is regulated at a post-translational level. In the absence of insulin, GLUT4 is largely excluded from the plasma membrane (hence low basal permeability for glucose) and is localized mainly inside the cell in small insulin-responsive vesicles (IRVs) and trans-Golgi network (TGN) that is likely to represent the IRV donor compartment. Upon insulin administration, the IRVs fuse with the plasma membrane and deliver GLUT4 to the site of its functioning. This increases the permeability of the plasma membrane for glucose, so that glucose uptake from blood into adipocytes and skeletal myocytes rises 10 to 40-fold. After insulin withdrawal, GLUT4 is internalized into early/sorting endosomes and then retrieved to TGN where the IRVs are re-formed. Both sorting steps in the GLUT4 pathway, i.e. retrieval from the peripheral early endosomes to the perinuclear TGN, and the formation of the IRVs on the TGN donor membranes are enabled by the Vps10p family member, sortilin, which represents a type I transmembrane protein and a sorting receptor. According to one model, sortilin works as a transmembrane scaffold protein: it binds GLUT4 in the lumen of endosomes and TGN, and recruits retromer or clathrin adaptors to the cytoplasmic side of the donor membrane via its C-terminus2,3. This facilitates the distribution of GLUT4 into vesicular carriers that translocate GLUT4 between intracellular compartments.
The interaction of the cytoplasmic tail of sortilin with retromer and various adaptor proteins has been well documented. However, the binding of sortilin to GLUT4 (and to several of its other protein ligands) has been challenging to prove. In particular, attempts to co-immunoprecipitate sortilin and GLUT4 have not been successful probably due to the detergent-sensitive nature of the interaction between these two proteins. In addition, as a typical transporter protein, GLUT4 has 12 transmembrane domains and 6 luminal loops any combination of which may potentially represent a sortilin-binding site. At the same time, a large body of indirect evidence, such as substantial co-localization in the cell, cross-linking with membrane-permeable DSP, and the interaction in yeast two hybrid system suggest that sortilin can bind to GLUT4. Furthermore, using the latter approach in a combination with the alanine scanning mutagenesis, we have previously determined that the Vps10p domain of sortilin binds primarily to the first luminal loop of GLUT4. However, the proof of such an interaction in mammalian cells has been missing. Here, we have isolated His-tagged sortilin from transfected 3T3-L1 cells using cobalt resin and demonstrated that it can interact with chemically synthesized peptide corresponding to the first luminal loop of GLUT4 at pH 6 and pH 8 that resemble acidic milieu in the endosomal lumen and neutral environment in the lumen of the TGN membranes. No peptide binding was detected in control experiments where extract prepared from non-transfected cells was loaded on the same beads.

<table><tbody><tr><td>Protease inhibitor cocktail</td><td>Sigma</td><td>P8849</td><td>for use in purification of histidine tag protein</td></tr><tr><td>Phosphate-Buffered Saline&amp;nbsp;</td><td>Corning</td><td>21-040-CV</td><td>PBS</td></tr><tr><td>1mL Insulin Syringe U-100</td><td>BD</td><td>329652</td><td>26G x 1/2</td></tr><tr><td>BCA Protein Assay Kit</td><td>Pierce</td><td>23228</td><td></td></tr><tr><td>Wash buffer</td><td>Boston BioProducts</td><td>BP-234</td><td>For His-tag protein purification</td></tr><tr><td>HisPur Cobalt Resin</td><td>Thermo Scientific</td><td>89964</td><td></td></tr><tr><td>Tricine sample Buffer</td><td>Bio-Rad</td><td>161-0739</td><td>with SDS, bMercaptaethanol should be added</td></tr><tr><td>Elution&amp;nbsp; Buffer</td><td>Boston BioProducts</td><td>BP-236</td><td>For His-tag protein purificationwith 250mM Imidazole</td></tr><tr><td>Mini-Protean Tris-Tricine precast gels 10-20%&amp;nbsp;</td><td>Bio-Rad</td><td>456-3115</td><td>For seperation of peptide and small protein</td></tr><tr><td>Tris/Tricine/SDS running buffer&amp;nbsp;</td><td>Bio-Rad</td><td>161-0744</td><td></td></tr><tr><td>Transfer Buffer</td><td>Boston BioProducts</td><td>BP-190</td><td>Add 20% methanol</td></tr><tr><td>Nitrocellulose membrane&amp;nbsp; 0.45 mm</td><td>Bio-Rad</td><td>1620115</td><td></td></tr><tr><td>Bovine Serum Albumin</td><td>Sigma</td><td>A9647</td><td>BSA</td></tr><tr><td>Anti Myc antibody</td><td>Cell Signaling</td><td>2272</td><td>Rabbit</td></tr><tr><td>Peptide</td><td>Genscipt</td><td></td><td>customize ordering</td></tr><tr><td>Precision Plus Protein Dual color Standarts</td><td>BioRad</td><td>161-0374</td><td></td></tr></tbody></table>

detection of detergent-sensitive interactions between membrane proteins

Detection of Detergent-sensitive Interactions Between Membrane Proteins

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein interactions in many cases is associated with significant experimental challenges. In particular, sorting receptors interact with their protein cargo in the lumen of the membrane compartments often in a detergent-sensitive fashion, making co-immunoprecipitation of these proteins unusable. Binding of the sorting receptor sortilin to glucose transporter GLUT4 may serve as an example of weak luminal interactions between membrane proteins. Here, we describe a fast, simple, and inexpensive assay to validate the interaction between sortilin and GLUT4. For that, we have designed and chemically synthesized the myc-tagged peptide corresponding to the potential sortilin-binding epitope in the luminal part of GLUT4. Sortilin tagged with six histidines was expressed in mammalian cells, and isolated from cell lysates using Cobalt beads. Sortilin immobilized on the beads was incubated with the peptide solution at different pH values, and the eluted material was analyzed by Western blotting. This assay can be easily adapted to study other detergent-sensitive protein-protein interactions.

Lysates were prepared from 3T3 L1 cells stably transfected with Sortilin-myc/His5 and from WT 3T3 L1 cells, used as a negative control. Both lysates were incubated with cobalt beads at pH 6 or pH 8 and thoroughly washed. Beads with immobilized proteins were then incubated in the solution of Myc-fll-Glut4. After careful washes, proteins bound to the beads were eluted with 0.25 M Imidazole. Samples were subjected, along with the original lysates, to SDS-PAGE in a 10-...

We describe a protocol for detection of detergent-sensitive interactions between membrane proteins using binding of the sorting receptor, sortilin, to the first luminal loop of the glucose transporter protein, GLUT4, as an example.

Our ability to explore protein-protein interactions is the key to understanding regulatory connections in the cell. However, detection of protein-protein ...

detection-detergent-sensitive-interactions-between-membrane

Research

JoVE Journal

Biochemistry

In this video, we demonstrate a fluorescence-detection size-exclusion chromatography technique to screen for green fluorescent protein (GFP)-fused membrane protein stability in Escherichia coli following detergent solubilization. Proteins exhibiting a symmetrical peak in the size-exclusion profile with little or no free GFP indicate purified proteins with minimum degradation and aggregation, which can subsequently be selected for structure-function analysis.

Fluorescence-Detection Size-Exclusion Chromatography: A Technique to Identify the Integrity of Fluorescent Membrane Proteins upon Detergent Solubilization

A biochemical approach is described to identify in vivo protein-protein interactions (PPI) of membrane proteins. The method combines protein cross-linking, affinity purification and mass spectrometry, and is adaptable to almost any cell type or organism. With this approach, even the identification of transient PPIs becomes possible.

Membrane-SPINE: A Biochemical Tool to Identify Protein-protein Interactions of Membrane Proteins In Vivo

A streamlined approach to screening for the expression of recombinant membrane proteins in Escherichia coli based on fusion to green fluorescent protein is presented.

Green Fluorescent Protein-based Expression Screening of Membrane Proteins in Escherichia coli

Many proteins perform their function when attached to membrane surfaces. The binding of extrinsic proteins on nanodisc membranes can be indirectly imaged by transmission electron microscopy. We show that the characteristic stacking (rouleau) of nanodiscs induced by the negative stain sodium phosphotungstate is prevented by the binding of extrinsic protein.

Method to Visualize and Analyze Membrane Interacting Proteins by Transmission Electron Microscopy

This protocol demonstrates how to obtain a low-resolution ab initio model and structural details of a detergent-solubilized membrane protein in solution using small-angle neutron scattering with contrast-matching of the detergent.

Contrast-Matching Detergent in Small-Angle Neutron Scattering Experiments for Membrane Protein Structural Analysis and Ab Initio Modeling

Here, we present a protocol for an on-membrane digestion technique for the preparation of samples for mass spectrometry. This technique facilitates the convenient analysis of protein–protein interactions.

Evaluation of Protein&#8211;Protein Interactions using an On-Membrane Digestion Technique

Microscale thermophoresis obtains binding constants quickly at low material cost. Either labeled or label free microscale thermophoresis is commercially available; however, label free thermophoresis is not capable of the diversity of interaction measurements that can be performed using fluorescent labels. We provide a protocol for labeled thermophoresis measurements.

Use of Microscale Thermophoresis to Measure Protein-Lipid Interactions

We present a method that combines membrane protein purification and reconstitution into peptidiscs in a single chromatographic step. Biotinylated scaffolds are used for direct surface attachment and measurement of protein-ligand interactions via biolayer interferometry.

PeptiQuick, a One-Step Incorporation of Membrane Proteins into Biotinylated Peptidiscs for Streamlined Protein Binding Assays

Presented here is a protocol for the determination of oligomeric state of membrane proteins that utilizes a native cell membrane nanoparticle system in conjunction with electron microscopy.

Native Cell Membrane Nanoparticles System for Membrane Protein-Protein Interaction Analysis

This paper describes a method for assessing the interactions and assemblies of integral membrane proteins in vitro with various partner factors in a lipid-proximal environment.

Using Scaffold Liposomes to Reconstitute Lipid-proximal Protein-protein Interactions In Vitro

Learn to detect detergent-sensitive interactions between membrane proteins using histidine and myc tagging techniques. This fast protocol enables study of weak protein interactions in biochemistry research.

Detection of Detergent-sensitive Interactions Between Membrane Proteins

Explore More Videos