Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identifizierung von Cyclin-abhängige Kinase 1 spezifische Phosphorylierung Websites durch eine In-vitro- Kinase Assay

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Cyclin-abhängige Kinase 1 (Cdk1) wird in der G2-Phase des Zellzyklus aktiviert und reguliert viele zelluläre Signalwege. Hier präsentieren wir ein Protokoll für eine in-vitro- Kinase Assay mit Cdk1, wodurch die Identifizierung von Cdk1-spezifische Phosphorylierung Websites für zellulare Ziele von diesem wichtigen Kinase.

Abstract

Cyclin-abhängige Kinase 1 (Cdk1) ist ein master-Controller für den Zellzyklus in allen Eukaryoten und schätzungsweise 8-13 % des Proteoms phosphorylates; die Anzahl der identifizierten Ziele für Cdk1, besonders in den menschlichen Zellen ist jedoch nach wie vor niedrig. Die Identifizierung von Cdk1-spezifische Phosphorylierung Websites ist wichtig, da sie mechanistische Einblicke in wie Cdk1 Zellzyklus steuert. Regulierung des Zellzyklus ist entscheidend für die treuen Chromosom Abtrennung und Mängel in diesen komplizierten Prozess zu Chromosomenaberrationen und Krebs führen.

Hier beschreiben wir einen in-vitro- Kinase Assay, der verwendet wird, um Cdk1-spezifische Phosphorylierung Sites zu identifizieren. In diesem Test ist ein gereinigtes Protein phosphorylierten in Vitro kommerziell verfügbare menschliche Cdk1/cyclin B. erfolgreich Phosphorylierung wird bestätigt durch SDS-PAGE und Phosphorylierung Websites werden anschließend durch Massenspektrometrie identifiziert. Wir beschreiben auch Reinigung-Protokolle, die Ausbeute sehr reine und homogene Protein Vorbereitungen für die Kinase Assay und eine verbindliche Assay für die funktionale Verifikation der identifizierten Phosphorylierung-Standorte, die die Interaktion zwischen den Sonden ein klassischer nuklearen Lokalisierung-Signal (cNLS) und seine Nukleartransporten Rezeptor Karyopherin α. Experimentelles Design unterstützen, überprüfen wir Ansätze für die Vorhersage von Cdk1-spezifische Phosphorylierung Sites von Proteinsequenzen. Zusammen stellen diese Protokolle einen sehr leistungsfähigen Ansatz, der Renditen Cdk1-spezifische Phosphorylierung Sites und mechanistische Studien in wie Cdk1 Zellzyklus steuert. Da diese Methode stützt sich auf gereinigten Proteinen, kann es zu jedem Modell Organismus und Erträge zuverlässige Ergebnisse, vor allem in Kombination mit Zelle funktionelle Studien angewendet werden.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinasen sind Enzyme, die Übertragung von Phosphatgruppen von ATP auf Substraten und regulieren viele zelluläre Prozesse. Diese Phosphorylierung ist reversibel, schnell, fügt zwei negative Ladungen und freie Energie speichert und gehört zu den häufigsten posttranslationale Modifikationen von Zellen verwendet. Cdk1, die auch bekannt als Zellteilung Zyklus Protein 2 Homolog (cdc2) ist ein master-Controller für den Zellzyklus in allen Eukaryoten1,2,3,4,5, und phosphorylates ein Geschätzte 8 bis 13 % des Proteoms6,7.

Während Proteomik-Studien haben viele Phosphorylierung Websites in den Proteinen, in den meisten Fällen identifiziert ist die Kinase verantwortlich für diese Änderungen unbekannt. Die Anzahl der bekannten Cdk1 Zielen, vor allem in menschlichen Zellen ist niedrig7. Die Identifizierung von Cdk1-spezifische Phosphorylierung Websites ist wichtig, da es mechanistische Studien, die festlegen ermöglicht, wie Cdk1 Zellzyklus steuert. Regulierung des Zellzyklus ist wichtig für Treue Chromosom Segregation und Zellteilung, und eine Vielzahl von zellulären Prozessen auftreten, um diese wichtige physiologische Funktion unterstützen müssen. Dazu gehören aufzuhalten, Transkription und Translation vor dem Beginn der Mitose sowie eine dramatische Reorganisation in zellulare Struktur und Organisation, z. B. Demontage der Kernhülle, Chromosom Kondensation und Montage der mitotischen Spindel. Deregulierung und Fehler in diesen Prozessen verursachen Krebs, Geburtsschäden oder mitotische Zelltod. Spezifische Inhibitoren des Cdk1 wie RO-3306 waren entwickelten8, die bieten leistungsstarke Tools für funktionelle Studien, und einige dieser Inhibitoren sind derzeit in klinischen Studien zur Behandlung von Krebs (siehe9 zur Überprüfung).

Hier beschreiben wir einen in-vitro- Kinase Assay, der die Identifizierung von Cdk1-spezifische Phosphorylierung Websites ermöglicht. In diesem Test wird kommerziell verfügbare menschliche Cdk1/cyclin B verwendet, um eine gereinigte Ziel Protein in Vitrophosphorylieren. Phosphorylierung eines Substrates erhöht seine Masse und fügt zwei negative Ladungen; daher bestätigt erfolgreiche Phosphorylierung eine aufwärts Verschiebung der Protein Gel Band auf SDS-PAGE. Cdk1-spezifische Phosphorylierung Websites werden anschließend durch Massenspektrometrie Analyse des Proteins in Vitro phosphoryliert identifiziert. Experimentelles Design unterstützen, überprüfen wir auch Berechnungswerkzeuge und Referenzen für die Vorhersage von Cdk1-spezifische Phosphorylierung Sites die Proteinsequenz. Darüber hinaus erläutern wir im folgenden Reinigung-Protokolle, die sehr reine und homogene Protein Vorbereitungen für die Kinase Assay ergeben. Schließlich identifizierte Phosphorylierung Websites durch funktionelle Studien überprüft werden müssen, und eine einfache Bindung-Assay wird hier beschrieben, für diesen Zweck. Kombiniert, ist dies ein sehr leistungsfähiges Ansatz, der Renditen Cdk1-spezifische Phosphorylierung Sites und mechanistische Studien in wie Cdk1 den Zellzyklus7,10,11 steuert. Da diese Methode auf gereinigten Proteinen angewiesen ist, kann es zu jedem Modell Organismus und Erträge zuverlässige Ergebnisse angewendet werden. Funktionale Überprüfung des erhaltenen Phosphorylierung Websites in Vitro wird jedoch empfohlen, wie Zellen zusätzliche regulatorische Mechanismen, z. B. posttranslationale Modifikationen, Interaktionspartner oder zellulären Lokalisation verfügen, kann Phosphorylierung Websites oder unzugänglich für die Anerkennung von Cdk1 rendern.

Cdk1 erkennt eine Konsens-Phosphorylierung-Website, die besteht aus (Ser/Thr-Pro-X-Lys/Arg), wo X ist keine Rückstände und ein Serin oder Threonin der Ort der Phosphorylierung ist. Besonders wichtig für die Anerkennung ist das Vorhandensein von Prolin in der + 1-Position. Darüber hinaus werden grundlegende Rückstände in den + 2 oder + 3 Positionen bevorzugt, mit die meisten Cdk1-spezifische Phosphorylierung Websites mit einer Lys oder Arg auf die + 3 position6,12.

Aktivierung des Cdk1 ist streng geregelt und führt zu Beginn der Mitose1,2,3,4,5. Im Allgemeinen hängt die Aktivität von cyclin-abhängigen Kinasen ihre Assoziation mit deutlichen Cyclin (cyclin A, B, C, D und E in den Menschen), die bei oszillierenden Ebenen in der gesamten Zellzyklus13ausgedrückt werden. Cdk1 Ausdruck ist konstant über den Zellzyklus und die Regulierung ihrer Tätigkeit stützt sich auf seine Assoziation mit den regulatorischen Untereinheiten cyclin A und cyclin B5,13,14,15, als gut als Post-translationalen Modifikationen. Bildung des Cdk1/cyclin B-Komplex ist erforderlich für die Kinase Aktivierung5,14,15,16,17,18. In der G2-Phase cyclin B übersetzt in das Zytosol und importiert in den Zellkern, wo es an Cdk15,14,15,16,17,18 bindet; jedoch wird Cdk1/cyclin B inaktiviert durch Phosphorylierung an Thr14 und Tyr15 Rückstände von der menschlichen Cdk1-hemmenden Kinasen Myt1 (cdc2-hemmenden membranassoziierten Tyrosin und Threonin-spezifische Kinase) und Wee1, bzw.19gehalten, 20,21. In der Spätphase der G2 Dephosphorylation Thr14 und Tyr15 durch Zellteilung Zyklus 25 Phosphatase (cdc25) aktiviert die Kinase-Aktivität des Cdk1/cyclin B-Komplex und löst die Einleitung der Mitose12,14, 18 , 20 , 22 , 23. Phosphorylierung des Thr161 auch für Cdk1/cyclin B Aktivierung ist erforderlich und wird durch Cdk7, die Aktivierung von Cdk-Kinase (CAK)18vermittelt. Abbau von cyclin B in Anaphase inaktiviert Cdk1, so dass Ausstieg aus Mitose24,25. Aktivierung des Cdk1/cyclin B wird daher ein komplizierter Prozess. Die hier vorgestellten Protokoll erfolgt mit handelsüblichen Cdk1/cyclin B. Während rekombinante Expression dieses Komplexes in Insektenzellen es aktiviert in Vivo durch endogene Kinasen14,20 ist und bleibt aktiv im gereinigten Zustand. Die daraus resultierende aktive, rekombinante menschliche Cdk1/cyclin B eignet sich für in-vitro- Kinase-Assays.

Hier beschreiben wir ein Protokoll für die Identifizierung von Cdk1-spezifische Phosphorylierung Websites in den menschlichen Zentromer Protein F (CENP-F)10. CENP-F ist ein Kinetochor-Protein, das befindet sich im Zellkern während der meisten Zeit der Interphase (G1 und S-Phase) und der Ausfuhr nach dem Zytosol in der G2 Phase26,27,28 in einer Cdk1-abhängigen Weise10, 11. nuklearen Lokalisierung durch einen zweiseitigen cNLS26gewährt wird. cNLSs werden von den Nukleartransporten Faktor Karyopherin α, erkannt, die zusammen mit Karyopherin β und RanGDP, die Einfuhr von cNLS-Cargo in den Zellkern29erleichtert. Nuclear Export in der G2-Phase wird über eine unbekannte Export Weg10erleichtert. Sobald CENP-F in die Zellflüssigkeit befindet, es wird eingestellt, um die Kernhülle und wiederum stellt den motor Protein Komplex dynien30,31. Dieser Weg ist wichtig, den Kern der Centrosome entsprechend während der Anfangsphase der mitotischen Spindel Baugruppe in ein dynien-abhängigen Weise positionieren ist wichtig für das richtige Timing der mitotischen Eintrag und ein grundlegender Vorgang im Gehirn Entwicklung30,31,32. Beginnend in der G2-Phase, wird CENP-F auch in das Kinetochor eingebaut wo hat wichtige Aufgaben für Treue Chromosom Abtrennung27,28,33,34,35 . Ein wichtigster regulatorische Schritt dieser Wege ist der nuklearen Export von CENP-F in der G2-Phase, die Cdk110,11abhängig ist. Wir beschreiben hier ein Protokoll für die Identifizierung von Cdk1-spezifische Phosphorylierung Websites in die cNLS CENP-f Phosphomimetic Mutationen dieser Seiten verlangsamen nuclear Import von CENP-F, was darauf hindeutet, dass Cdk1/cyclin B direkt zellulären Lokalisation der CENP-F durch Phosphorylierung von seinem cNLS10regelt.

Insgesamt, dieser in-vitro- Kinase Assay ermöglicht die Identifikation von spezifischen Substraten für die Kinase Cdk1. Purified Zielproteine phosphorylierten in Vitro durch die im Handel erhältlichen Cdk1/cyclin B-Komplex und die Phosphorylierung Websites sind werden anschließend durch Massenspektrometrie identifiziert. Die Identifikation des Cdk1-spezifische Phosphorylierung Sites unterstützt mechanistische Studien, die zeigen, wie Cdk1 Zellzyklus steuert.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

(1) Vorhersage von Cdk1-spezifische Phosphorylierung Webseiten, die auf die Proteinsequenz

  1. Analysieren Sie vor Beginn der Kinase Assay die Proteinsequenz für vorhergesagten Cdk1-spezifische Phosphorylierung Sites und suchen Sie die Literatur für experimentell etablierten Phosphorylierung Websites mit unbekannten Kinase Spezifität zu. Verwenden Sie die folgenden Tools, Datenbanken und Referenzen, die zusammengefasst sind.
    1. Verwenden Sie die iGPS 3.0 Software36,37 (http://gps.biocuckoo.org/online_full.php) Cdk1-spezifische Phosphorylierung Sites in der Zielsequenz Proteins vorherzusagen. Verwenden Sie den Link hier für eine umfassende Vorhersage, die Anmerkungen der Sekundärstruktur und Oberfläche Zugänglichkeit enthält.
    2. Geben Sie in der Software die Proteinsequenz im FASTA-Format. Überprüfen Sie für Kinase Spezifität Serin/Threonin-Kinase, Zolltransitdokumente, CDK, CDC2 CDK1zu, und deaktivieren Sie alle anderen Besonderheiten. Klicken Sie auf Mittel als die Schwelle, und klicken Sie auf die Schaltfläche " senden ".
    3. Vergleichen Sie die resultierende vorhergesagten Sites mit Cdk1 Konsens Phosphorylierung Website (Ser/Thr-Pro-X-Lys/Arg).
    4. Wichtig ist, überprüfen Sie die vorhergesagte Website für die Proline neben der phosphorylierten Rückstand (einige Cdk1 Substrate sind bei einer minimalen Website (Ser/Thr-Pro)6,12phosphoryliert). Überprüfen Sie darüber hinaus grundlegende Rückstände, die in den + 2 oder + 3 Positionen, mit die meisten Cdk1-spezifische Phosphorylierung Websites mit einer Lys oder Arg auf der + 3 Position6,12bevorzugt werden.
  2. Überprüfen Sie auch die Website für die Anerkennung, zugänglich ist, wie das Vorhandensein einer vollständigen Konsens-Website für Cdk1 Phosphorylierung nicht ausreicht.
    1. Überprüfen Sie die Oberfläche Zugänglichkeit und Sekundärstruktur Vorhersage Anmerkung in der iGPS-Ausgabe, die besagt, ob die Website vorhergesagt wird, zugänglich zu machen; N - und C-Termini der Proteine sind in vielen Fällen flexibel und zugänglich für Phosphorylierung.
    2. Wenn eine x-ray-Struktur des Zielproteins verfügbar ist, überprüfen Sie vermeintliche Phosphorylierung-Zugang durch die Überprüfung ihrer Position in der Struktur.
  3. Suche Literatur für experimentell etablierten Phosphorylierung Websites mit unbekannten Kinase Spezifität mit UniProtKB/Swiss-Prot Datenbank38 (http://www.uniprot.org).
    1. Geben Sie den Namen des Proteins in das Suchfeld ein und klicken Sie auf die Schaltfläche " Suchen ". Wählen Sie die richtige Reihenfolge-Eintrag. Phosphorylierung Websites sind kommentiert und im Abschnitt Aminosäure Änderungen verwiesen.
    2. Suche für Proteomics Studien der mitotischen Auszüge aus menschlichen Zelle Linien7,39,40, die besonders nützlich sind, weil Cdk1 aktiv in der G2-Phase des Zellzyklus wird.
  4. Zweiseitigen cNLS durch NLSmapper (optional) zu identifizieren.
    Hinweis: Für Proteine, die shuttle zwischen dem Zytosol und der Kern, ist ein gemeinsamer Mechanismus für die Regulierung der zellulären Lokalisation der Phosphorylierung des zweiseitigen cNLS in die-1 Position des großen Motiv von Cdk1. Die Phosphorylierung abschafft nuklearen Lokalisierung in die G2 Phase10,41,42,43.
    1. Identifizieren Sie für solche pendelt Proteine die cNLS in die Proteinsequenz durch NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Die Proteinsequenz als Text im Feld Sequenz einfügen, wählen Sie einen Cut-Off-Wert von 5,0 und suchen die NLS in der gesamten Regionzu wählen. Klicken Sie auf Vorhersagen NLS .
    2. Vergleichen Sie die daraus resultierenden vorhergesagten cNLS gegen die Konsensussequenz einen zweiseitigen cNLS, bestehend aus das kleine Motiv (Lys-Arg), ein Linker mindestens 10 Rückstände und das große Motiv (Lys-Lys/Arg-X-Lys/Arg), wo X ist keine Rückstände, die nicht negativ geladen ist .
    3. Überprüfen Sie, ob die prognostizierte Cdk1 Phosphorylierung Website (*) sich neben dem großen Motiv in der-1-Position des Linkers befindet: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Hinweis: Die Phosphorylierung des zweiseitigen cNLS in die Position-1 Cdk1 entstand als Regelmechanismus für zellulären Lokalisation für mehrere pendelt Proteine10,41,42, 43.

(2) Expression rekombinanter Proteine in Escherichia Coli

  1. Verwenden Sie die Ausdruck Plasmiden von Schritte 2.1.1-2.1.2 für den Ausdruck von rekombinanten Proteinen in E. Coli.
    1. Um dem menschlichen CENP-F (Rückstände 2.987 3.065) Ausdruck erstellenerstellen, generieren Einsätze durch die Verstärkung von DNA-Fragmente durch Polymerase-Kettenreaktion (PCR) von einem Full-Length CENP-F-Konstrukt (GenBank Beitritt: U19769.1). Verwenden Sie die folgenden Primer: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG und AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Hinweis: Das Full-Length menschlichen CENP-F-Plasmid wurde großzügig von Dr. X. Zhu, Institute for Biological Sciences, chinesische Akademie von Wissenschaften, Shanghai, China zur Verfügung gestellt.
      1. Klonen Sie die Einlage in den pGEX6p1-Vektor mit BamHI und XhoI Restriktionsschnittstellen. Verwenden Sie dieses Plasmid N-terminale Glutathion S-Transferase (GST) Fusionsproteine CENP-f (Rückstände 2.987 3.065) zum Ausdruck bringen.
        Hinweis: GST-Tag können Sie durch die PreScission Protease (im folgenden als PS Protease bezeichnet) abgespalten.
    2. Für die menschliche Karyopherin α-Ausdruck erstellen, generieren Einsätze durch die Verstärkung von DNA-Fragmente mittels PCR aus einer durchgehenden Karyopherin α2 cDNA Vorlage (Sequenz Beitritt NM_002264.3; Primer: GCACTACATATGTCCACCAACGAGAATGCTAATA und TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Hinweis: Aufgrund der Ähnlichkeit der Isoformen, ist dieses Karyopherin α2-Konstrukt im nachfolgenden Text als Karyopherin α bezeichnet.
      1. Klonen Sie die Einlage in den pET28a-Pres-Vektor mit NdeI und XhoI Restriktionsschnittstellen.
        Hinweis: Dies ist eine modifizierte pET28a Vektor, in dem die Sequenz-Codierung für die Thrombin-spaltstelle durch eine Sequenz ersetzt wurde, die für eine PS-Protease-spaltstelle kodiert. Dieses Plasmid verwenden, um ein Schmelzverfahren Protein der Karyopherin α mit einer N-terminalen seiner6auszudrücken-Tag, wo die seine6-Tag aus durch PS-Protease gespalten werden kann.
  2. Führen Sie Site-verwiesene Mutagenese mit einem Kit, um Punktmutationen an ein Zielproteinzu erstellen.
  3. Die rekombinanten Proteinen in E. Coli für die anschliessende Reinigung Ausdrücken.
    1. Machen Sie folgende Bestände: 50 mg/mL Kanamycin (1:1, 000-Stammlösung), 35 mg/mL Chloramphenicol in 70 % Ethanol (1:1 000), 100 mg/mL Ampicillin (1:1, 000) und 1 M Isopropyl β-D-1-Thiogalactopyranoside (IPTG; 1:5, 000).
    2. Steril filtern die Bestände und Lagerung bei-20 ° C. Vermeiden Sie wiederholte Frost-Tau-wechseln für IPTG.
    3. Verwandeln Sie 1 µL expressionsplasmid in 50 µL kompetente Zellen des Stammes E. Coli Rosetta 2 (DE3) pLysS, gemäß den Anweisungen des Herstellers.
    4. Platte die Kultur auf Agar Luria-Bertani (LB) mit Chloramphenicol (35 µg/mL LB) und Ampicillin (100 µg/mL LB) für die CENP-F Konstrukt oder Chloramphenicol und Kanamycin (50 µg/mL Kultur) für das Karyopherin-α-Konstrukt. Inkubieren Sie die Platten für 12-20 h bei 37 ° c
    5. Wählen Sie eine einzelne Kolonie und impfen Sie 50 mL LB ergänzt mit Antibiotika (siehe Punkt 2.3.4) zu. Inkubieren Sie die Vorkultur unter Schütteln bei 160-180 u/min für 12-20 h bei 37 ° c
    6. Bereiten Sie 1 L LB Medium in einer 2.800 mL verblüfft Fernbach Kolben. Zwei Fläschchen für jede Vorkultur und Autoklaven machen sie. Um die Belüftung zu ermöglichen, füllen Sie die Kolben zu mehr als zwei Drittel der Flasche Volumen nicht. Erlenmeyerkolben können auch verwendet werden.
    7. Antibiotika (Schritt 2.3.4) und 10 mL einer sterilen gefiltert 40 % (w/V) Glukose-Lösung pro 1 L von gekühlten lb hinzufügen 20 mL Vorkultur pro 1 L LB-Medium hinzufügen.
      Hinweis: Die Extinktion bei 600 nm eine 01:10 Verdünnung von der Vorkultur zwischen 0,15-0,2 sollen.
    8. Inkubieren Sie die Kolben unter Schütteln bei 160-180 u/min bei 37 ° c Messung der Extinktion bei 600 nm der Bakterienkultur regelmäßig. Wenn die Extinktion 0,5-0,6 erreicht, induzieren Proteinexpression durch Zugabe von 0,2 mM IPTG (200 µL 1 M Lager pro 1 L LB-Medium).
      Hinweis: Es ist wichtig, dass die Zellen auf die korrekte Absorption induziert werden. Normalerweise dauert es 3 bis 4 h, um dieses Stadium zu erreichen.
    9. Inkubieren Sie die Kolben beim Schütteln für 3 h bei 37 ° c Ernte der Zellen durch Zentrifugation (15 min, 4.100 x g, 4 ° C, ausschwenkbare Rotor). Verwerfen Sie den überstand. Aufschwemmen der Zelle-Pellets in 20 mL GST-Bindung Puffer (CENP-F) oder seine6-Bindung Puffer (Karyopherin α) pro 1 L Kultur. Speichern Sie die Zellen bei-80 ° C.
      1. Vorbereiten den GST-Bindung-Puffer (10 mM Tris pH 8.0 bei 25 ° C, 150 mM NaCl, 1 mM Dithiothreitol (DTT), 0,5 mM EDTA) und seine6-Puffer (10 mM Tris pH 8.0 bei 25 ° C, 250 mM NaCl, 5 mM Imidazol pH 8,0, 5 mM β-Mercaptoethanol (BME)) im Voraus verbindlich.

3. Reinigung des rekombinanten Proteins durch Glutathion-Affinitätschromatographie und Gel Filtration

  1. Machen Sie folgende Bestände: 1 M DVB-t (1:1, 000 Lager, steril mit 0,2 µM Porengröße filtriert und entgast); 250 mM Phenylmethylsulfonyl Fluorid (PMSF; 1:1,000 Lager in Dimethylsulfoxide). Shop bei-20 ° C. Vermeiden Sie wiederholte Frost-Tau-wechseln.
  2. Die folgenden Puffer zu machen und auf 4 ° c abkühlen
    1. Bereiten Sie den GST-Bindung Puffer mit 10 mM Tris pH 8.0 bei 25 ° C, 150 mM NaCl, 1 mM DTT, 0,5 mM EDTA.
    2. Bereiten Sie den GST-Elution Puffer mit 10 mM reduziert Glutathion (0,15 g/50 mL) in einem Puffer von 50 mM Tris pH 8.0 bei 25 ° C, 150 mM NaCl, 1 mM DTT aufgelöst. Bestätigen Sie, dass der pH-Wert des Puffers endgültige 8.0 ist und verwenden Sie am selben Tag, die, den es gemacht wurde.
    3. Bereiten Sie den Gel-Filtration-Puffer mit 20 mM Tris pH 7,5 bei 25 ° C, 60 mM NaCl, 2 mM DTT. Steril Filtern den Puffer mit einem Flaschenverschluss Filter (0,2 µM Porengröße). Entgasen Sie den Puffer unter Rühren unter Vakuum (-6 Psi) für 15 min.
    4. Fügen Sie DVB-t, alle oben genannten Puffer am Tag der Nutzung.
  3. Tauen Sie die Zellen aus Abschnitt 2, DIE CENP-F Konstrukt enthalten. Stellen Sie die Lautstärke auf 40 mL mit dem GST-Bindung-Puffer. Fügen Sie 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0,5 M-Stammlösung, pH 8,0), 7 mg Benzamidine Hydrochlorid (1 mM) und 40 mg D/L Methionin.
    Hinweis: Um proteolytischen Abbau zu verringern, führen Sie alle Schritte bei 4 ° C, vorzugsweise in einem kalten Raum, sofern nicht anders angegeben. Halten Sie Zellen, Lysates und gereinigtes Proteinfraktionen auf Eis zu allen Zeiten, und fügen Sie Protease-Inhibitoren. Um Oxidation von Cystein und Methionin Rückstände zu verhindern, fügen Sie Reduktionsmitteln wie DVB-t und Methionin am Tag des Experiments. Um proteolytischen Abbau zu reduzieren, arbeiten Sie schnell durch die einzelnen Schritte.
  4. Lyse der Zellen in einem sonikator wie folgt. Ein Becherglas mit der lysate füllen und in ein Eis-Wasserbad eintauchen. Beschallen Sie die Kultur (1 min 40 s, bei 100 W (50 %) Ausgang/Amplitude, mit 10 s Impulse und 10 s Rest Zyklen). Fügen Sie 250 µM PMSF nach Beschallung. Überprüfen Sie die Zelle lysate, die sollten transparenter und nicht mehr dickflüssig sein.
  5. Klar die lysate durch Zentrifugieren bei 12.000-40.000 x g, 25 min, 4 ° C. Verwenden Sie Rundboden Zentrifuge Röhren und einem festen Winkel Rotor.
  6. Durchführen Sie Gewichtsausgleich durch Zugabe von 2 mL Glutathion Agarose 1:1 Gülle zu einem Einweg Chromatographiesäule. Die Ergebnisspalte haben ein Volumen von 1 mL. Waschen Sie die Spalte mit 25 mL Reinstwasser und 25 mL GST-Bindung Puffer.
  7. Durchzuführen Sie Bindung wie folgt. Arbeiten in einem Kühlraum oder cold-Box, Dekantieren Sie lysate aus den Pellets. Filtern der lysate (0,2 µm Porengröße) und Gießen Sie sie auf die Säule gesteckt. Verschließen Sie die Spalte und gleichzeitig sanft Nutating für 30 min bei 4 ° c inkubieren
  8. Waschen Sie die Spalte legen Sie es auf einem Gestell lassen Sie das Harz zu begleichen, und sammeln Sie die Durchströmung. Waschen Sie die Spalte zweimal mit 25 mL GST-Bindung Puffer.
  9. Eluieren Sie durch proteolytische Spaltung.
    1. Stecken Sie die Spalte. Fügen Sie 400 µL der GST-Bindung Puffer und 250 µL PS Protease (2 mg/mL Brühe mit einer Aktivität von 1.000 U/mg, entweder im Labor gereinigt oder gekauft, siehe Tabelle der Materialien hinzu).
    2. Verschließe die Spalte und sanft schwenken, um das Harz in den Puffer aufzuwirbeln. Inkubieren Sie die Spalten für 16-20 h bei 4 ° c Fügen Sie dann 4 mL GST-Bindung Puffer zu eluieren proteolytisch gespalten CENP-F-Fragment aus der Spalte.
  10. Glutathion elution
    1. Stecken Sie die Spalte fügen Sie 4 mL von GST-Elution Buffer (4 Spalte Volumen hinzu) und inkubieren Sie für 10 min in der gebundenen GST-Tag eluieren. Das Eluat zu sammeln. Die Spalten vor der Wiederverwendung zu regenerieren, wie vom Hersteller beschrieben.
  11. Analysieren der PS Protease Elution Bruch und Glutathion Elution Bruchteil von SDS-PAGE auf 16 % Acrylamid Gele. Durchführen Sie die Gele von Coomassie blau Elektrophorese mit 25 V/cm für 45 min. Fleck. Die PS Protease Bruch wird das gereinigte CENP-F-Fragment enthalten, während die Glutathion-Fraktion gespalten GST-Tags enthalten sein wird. Inspizieren Sie das Gel zur Beurteilung der Effizienz der proteolytischen Spaltung.
  12. Konzentrieren sich die PS Protease-Eluat bis 0,5 mL mit zentrifugalen Filtereinheiten mit einem Molekulargewicht von 3 kDa cutoff (siehe Tabelle der Materialien). Fügen Sie das Eluat in das obere Fach des Filters und Zentrifugieren Sie es in 10-15 min-Schritten bei 4.100 x g, 4 ° C (ausschwenkbare Rotor), die Probe zu konzentrieren. Mischen Sie, indem Sie nach jedem Schritt pipettieren.
  13. Eine geeignete gel Filtration Spalte zu verbinden (siehe Tabelle der Materialien für den Erwerb von Informationen) zu einem schnellen Protein Flüssigkeitschromatographie (FPLC) System, und mit 1 Spalte Volumen von Gel Filtration Puffer equilibrate.
  14. Zentrifugieren Sie das konzentrierte CENP-F-Fragment in einem Microcentrifuge (20 min, 21.700 x g, 4 ° C). Einlegen der Probe auf die Säule und mit 1 Spalte Volumen von Gel Filtration Puffer eluieren. 0,6 mL Fraktionen zu sammeln.
    Hinweis: Die Gel-Filtration-Puffer ist für die Kompatibilität mit dem nachfolgenden Kinase Assay optimiert. Testen Sie, ob das Zielprotein in diesen Puffer stabil ist. Wenn es nicht stabil ist, versuchen Sie, mehr Natrium-Chlorid.
  15. Analysieren Sie die Peak-Brüche durch SDS-PAGE (Schritt 3.11). Bündeln Sie die Peak-Fraktionen, die reine CENP-F-Fragmente enthalten. Die gereinigten CENP-F-Fragmente zu konzentrieren , bis 3,3 mg/mL (Schritt 3.12). Analysieren Sie die gereinigten CENP-F-Fragmente durch SDS-PAGE (Schritt 3.11).
  16. Protein-Konzentrationsbestimmung
    1. Verdünnen der Probe 1: 100 in Reinstwasser und legen Sie sie in ein Quarz Mikro-Küvette. Rekord-Spektren in einem Wellenlängenbereich von 220-300 nm in einem Spektrophotometer.
      Hinweis: Die Protein-Konzentration c (mg/mL) leitet sich aus der folgenden Gleichung:
      Equation
  17. 50 µL-Aliquots des gereinigten Proteins in 0,5 mL mikroröhrchen und Schockfrosten machen Sie in flüssigem Stickstoff. Speichern der Aliquote bei-80 ° C.

4. Reinigung des rekombinanten Proteins durch Ni-NTA Affinitätschromatographie

  1. Die folgenden Puffer zu machen und auf 4 ° c abkühlen lassen
    1. Vorbereiten der seiner6-Bindung Puffer mit 10 mM Tris pH 8.0 bei 25 ° C, 250 mM NaCl, 5 mM Imidazol pH 8,0, 5 mM BME. Alle Puffer BME am Tag der Verwendung hinzufügen.
    2. Vorbereiten der seiner6-Waschpuffer auf die gleiche Weise wie die seine6-Puffer verbindlich, aber mit 20 mM Imidazol.
    3. Vorbereiten der seiner6-Elution Buffer in der gleichen Weise wie die Bindung Puffer aber mit 150 mM Imidazol.
  2. Auftauen der Zellen aus Abschnitt 2, die die Karyopherin α enthalten konstruieren und stellen Sie die Lautstärke auf 40 mL mit seinem6 -Bindung Puffer. 5 mM BME, 0,250 mM PMSF, 7 mg Benzamidine Hydrochlorid (1 mM) und 40 mg D/L Methionin hinzufügen.
    1. Gehen Sie wie in den Schritten 3,4-3,8 mit folgenden Varianten beschrieben: Verwenden Sie seine6-Bindung Puffer anstelle von GST-Bindung Puffer für alle Schritte. Anstelle von Glutathion Agarose, verwenden die Nickel-Affinität 4 mL gel (siehe Tabelle der Materialien), um die Spalte zu bilden, die eine Spalte Volumen von 2 mL haben wird.
      Hinweis: Nickel Affinität Spalten sind nicht kompatibel mit DVB-t und EDTA. Anstelle von Nickel Affinität Gel, Ni2 +- Nitrilotriacetic Säure (NTA) Agarose eingesetzt werden, wenn die Imidazol-Konzentration in der Elution Buffer auf 250 mM erhöht wird (siehe Tabelle der Materialien).
  3. Waschen die Spalten mit seinen68 mL-Waschpuffer.
  4. Elute die Karyopherin α mit 12 mL seine6-Elution buffer und Eluat durch SDS-PAGE (Schritt 3.11) zu analysieren.
  5. Fügen Sie 250 µL Protease PS (Schritt 3,9), das Eluat und 16-20 h bei 4 ° c inkubieren In der Zwischenzeit das Eluat zweimal gegen 1 L seine6Dialyse-Bindung Puffer für 2-20 h, mit einem 6-8 kDa Molekulargewicht cutoff eine Dialysemembran.
  6. Regenerieren Sie die Nickel-Affinität-Gel-Spalte, wie vom Hersteller beschrieben. Equilibrate die Spalte mit 25 mL seine6-Bindung Puffer. Die Spalte fügen Sie der dialysierten Eiweiß hinzu und führen Sie den verbindlichen Schritt aus , wie unter Punkt 3.7 beschrieben.
  7. Die Durchströmung zu sammeln, die gereinigten Karyopherin α enthält (mit seinem6-Tag gespalten aus), und eluieren das restliche Protein mit einer zusätzlichen 4 mL seine6-Bindung Puffer. Diese Fraktionen zu bündeln. Dann die Spalten mit 12 mL seine6eluieren-Elution Puffer. Dieser Teil enthält Verunreinigungen.
  8. Analysieren der uncleaved und gespalten Karyopherin α von Schritten 4,4-4,5 und die beiden Fraktionen der Elution von diesem Schritt durch SDS-PAGE (Step 3.11), die Effizienz seiner6zu bewerten-tag-Spaltung und Reinheit.
  9. 8 mg/mL und Schockfrosten in flüssigem Stickstoff (Schritte 3.15-3.17) konzentrieren sich die Karyopherin α .

5. in-vitro- Kinase Assay mit Cdk1/Cyclin B

  1. In-vitro- Kinase assay
    Hinweis: Bei der Ankunft die Kinase, kleine aliquoten, Schockfrosten sie in flüssigem Stickstoff und speichern Sie diese bei-80 ° C. Verwenden Sie innerhalb von 6 Monaten. Während das Molekulargewicht 34 kDa für Cdk1 und 48 kDa für cyclin B, ist die scheinbare Molekulargewicht von cyclin B auf SDS-PAGE ca. 60 kDa.
    1. Bereiten Sie die 10 x PK Puffer (im Lieferumfang der Kinase) mit 0,5 M Tris-HCl, 0,1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0,1 % Brij 35, pH 7,5 bei 25 ° C.
    2. 10 x ATP-Vorrat vorbereiten: eine Lösung von 4 mM ATP in 1 x PK Puffer zu machen, und überprüfen Sie die endgültigen pH-Wert des Bestands. Vermeidung von Frost-Tau-wechseln und kleine Aliquote bei-20 ° C lagern.
    3. Mix-40 µL CENP-F fragment (in einer Konzentration von 3,3 mg/mL oder 400 µM), 6 µL 10 x PK-Puffer, 3 µL Reinstwasser, 6 µL ATP 10 X Lager und 5 µL menschlichen Cdk1/cyclin B (1 µg, 100 U) in eine 0,5 mL reaktionscup.
      Hinweis: Die CENP-F-Fragment hat eine molare Masse von 8,6 kDa und vier Cdk1-spezifische Phosphorylierung Sites. Für ein neues Substrat Einstellen der Kinase-Konzentration in der Probe nach der molaren Konzentration des Proteins und die Anzahl der Phosphorylierung Websites. Die Tätigkeit der menschlichen rekombinante Cdk1/cyclin B-Ware ist 20.000 U/mL, und die spezifische Aktivität liegt bei 1.000.000 U / mg. 1 U ist definiert als die Menge an Cdk1/cyclin B erforderlich, um die Übertragung von 1 Pmol von Phosphat an Cdk1 Peptid Substrat PKTPKKAKKL-NH2 katalysieren (50 µM) in 1 min bei 30 ° C (siehe Tabelle der Materialien).
    4. Bereiten Sie eine Kontrollreaktion ohne Cdk1/cyclin B. Incubate Reaktionen in einem Wasserbad für 1-16 h bei 30 ° C.
  2. 2.5 µL der Kinase Assay Reaktion zu analysieren und 2,5 µL des Steuerelements durch SDS-PAGE (Step 3.11), Verwendung eines Gels mit 16 % Acrylamid. Um die Auflösung zu erhöhen, die Laufzeit zu verlängern.
  3. Fügen Sie ein gleiches Volumen 6 M Guanidin-Hydrochlorid-Lösung der verbleibenden Kinase Assay Reaktion (und an die Steuerung). Die endgültige Guanidin-Hydrochlorid-Konzentration werden 3 M. analysieren diese Proben durch Massenspektrometrie (Kap. 6) identifizieren Phosphorylierung oder eine Massenspektrometrie-Anlage zur Analyse der Proben schicken und dann ausführen Überprüfung () Funktion (Siehe Abschnitt 7).
    Hinweis: Für die anschließende Massenspektrometrie-Analyse ist es sehr wichtig, dass die Phosphorylierung Effizienz der einzelnen Seiten ist so hoch wie möglich, vorzugsweise 100 %, da sonst die Phosphorylierung Websites können nicht zugeordnet werden. Stark Phosphorylierung Effizienz, größere Mengen an Cdk1/cyclin B hinzufügen und die Inkubationszeit bis 16 h zu erhöhen. Die Konzentration von ATP kann auch verdoppelt werden.
  4. Für die Problembehandlung durchführen eines in-vitro- Kinase Assays CENP-f (Rückstände 2.987 3.065) als Positivkontrolle. Verwenden Sie frische Chargen des Cdk1/cyclin B mit hohen Aktivitäten.

6. Bestimmung der Cdk1-spezifische Phosphorylierung Standorte durch Massenspektrometrie

  1. Führen Sie zu denaturieren und die Proteinproben Entsalzen, Microbore umgekehrter Phase Flüssigchromatographie mit einer PLRP300-Spalte.
  2. Um die Anzahl der Phosphorylierung Standorte im CENP-F Fragment zu erhalten, analysieren Sie die intakt in Vitro phosphoryliert CENP-F 84-Mer durch Electrospray Ionisierung Ionenfallen Massenspektrometrie (ESI-ITMS)44,45.
  3. Zur Beurteilung der Phosphoamino sauren Standort des CENP-F phosphoryliert bereiten die Trypsin verdaut , des in-vitro- Proteinproben CENP-F. Entsalzen Sie die Trypsin verdaut mit pipettieren Tipps Entsalzung.
  4. Analysieren Sie die Folgen Übersichten der CENP-F durch Electrospray Ionisierung Fourier transformieren Ion Cyclotron Resonance Massenspektrometrie (MS ESI-FTICR). Führen Sie Analysen auf eine ESI-FTICR Massenspektrometer mit einer Ansammlung von 169 µs.
    Hinweis: Die Genauigkeit der Massen von ESI-FTICR MS bestimmt ist innerhalb von 0,005 amu. Um das Verhältnis der einzelnen phosphorylierten Arten jeweils auf die Gesamt-Protein-Menge zu quantifizieren, bestimmen Sie die Peak-Höhen von der Massenspektren.

7. funktionale Verifikation: Prüfung der Auswirkungen von Phosphomimetic Mutationen auf Protein-Protein-Wechselwirkungen durch analytische Größe Ausgrenzung Chromatographie

Hinweis: für die funktionelle Überprüfung der identifizierten Cdk1-spezifische Phosphorylierung Websites, Phosphomimetic Mutanten CENP-F Fragmente entstanden , indem die identifizierten Phosphorylierung Standorte mit Aspartates. Die negative Ladung der Aspartate ahmt die Wirkung von Phosphorylierung. Eine S3048D Mutante des Fragments CENP-F (Rückstände 2.987 3.065) entstand.

  1. Für funktionale Verifikation die Bindung von Wildtyp vergleichen und CENP-F Phosphomimetic Fragmente Karyopherin α. verwenden Sie eine analytische Gel Filtration als verbindliche Assay. Für die analytische Gel Filtration CENP-F-Fragmente durch Glutathion-Affinitätschromatographie (Schritte 3.1-3.12) zu reinigen und den Gel Filtrationsschritt überspringen.
  2. Das Protein 5-6 mg/mL zu konzentrieren. Schockfrosten Sie Protein Aliquots in flüssigem Stickstoff (Schritte 3.15-3.17).
  3. Mix der gereinigten CENP-F-Fragmente (0,1 mg Wildtyp oder die S3048D Variante) und gereinigt Karyopherin α (0,7 mg) in einem Molverhältnis von 1:1. Die Probe-Lautstärke zu 200 µL mit Gel Filtration Puffer. Inkubation der Probe für 30 min auf Eis, Filtern Probe (0,2 µm Porengröße) und deaktivieren Sie die Probe durch Zentrifugieren (25 min, 21.700 x g, 4 ° C)
  4. Trennen Sie die Probe durch Größe Ausgrenzung Chromatographie (Schritte 3.13-3.14). Verwenden Sie einen Gel Filtration Puffer bestehend aus 20 mM HEPES, pH 7.5, 150 mM NaCl, und 2 mM DTT. Durchführen Sie die analytische Gel Filtration Experimente unter identischen Bedingungen für alle Proben.
  5. Die analytische Gel Filtration Spalte mit Molekulargewicht Standards bekannter Molmasse zu kalibrieren, wie vom Hersteller beschrieben.
  6. Analysieren der Elution Fraktionen um 16 % SDS-PAGE (Schritt 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Wir haben vor kurzem einen in-vitro- Kinase Assay (Abbildung 1) verwendet, um Cdk1-spezifische Phosphorylierung Seiten in einem Fragment CENP-F zu ermitteln, die ein cNLS10enthalten. Dieses Signal verleiht nuklearen Lokalisierung von CENP-F während des größten Teils der Interphase. In der G2-Phase ist CENP-F aus dem Zellkern in das Zytosol in gewissem Sinne Cdk1-abhängige exportiert. Mechanistische Einblicke, wie Cdk1 regelt die zellulären Lokalisation der CENP-F erhalten analysiert wir die Reihenfolge der CENP-F Cdk1-spezifische Phosphorylierung Sites vorherzusagen mit iGPS Server36,37. Innerhalb der cNLS CENP-F, wurden drei Cdk1-spezifische Phosphorylierung Sites auf Rückstände 3.042, 3045, vorausgesagt und 3.048 (Tabelle 1). Ein weiterer Cdk1-spezifische Phosphorylierung Website wurde auch für Rückstände 3.007 (Tabelle 1)10vorhergesagt. Daher vermutet wir, dass Cdk1 CENP-F Lokalisierung direkt durch Phosphorylierung von seiner cNLS regelt.

Zu testen, ob die cNLS CENP-F ein Substrat für Cdk1 ist, wir einen in-vitro- Kinase Assay mit dem gereinigten menschlichen CENP-F-Fragment (Rückstände 2.987 3.065 führten) und menschliche Cdk1/cyclin B. In-vitro- CENP-F phosphoryliert wurde analysiert, auf 16 % SDS-PAGE zusammen mit einer negativ-Kontrolle, die die Kinase Cdk1 fehlte (Abbildung 2A)10. Für in-vitro- CENP-F phosphoryliert, wird ein klaren Aufwärtstrend Wandel für die Band auf dem Gel im Vergleich zu der negativen Kontrolle beobachtet. Dies ist typisch für phosphorylierten Proteine, da jeder Phosphatgruppe zwei negative Ladungen und zusätzliche Masse hinzufügt. Diese Ergebnisse deuten darauf hin, dass CENP-F von Cdk1/cyclin B10phosphoryliert wird.

Bestimmen die Anzahl der CENP-F Phosphorylierung Standorte und die Phosphorylierung Effizienz dieser Seiten zu quantifizieren, wurde das intakt in Vitro phosphoryliert CENP-F Fragment (84-Mer) von Massenspektrometrie (ESI-ITMS)10analysiert. Die beobachteten ESI-Ion Trap Massenspektrum (Abb. 2 b) legt nahe, dass die intakte CENP-F-Fragment an vier Standorten (Tabelle 1)10phosphoryliert wird.

Die Position der phosphorylierten Aminosäure-Standorte in der Reihenfolge der CENP-F wurden abgeschätzt, indem Prüfung folgen Zusammenfassungen von ESI-FTICR Frau Trypsin zerspaltet Proteinketten nach Lysines und Arginines, und ein Trypsin-Digest des Fragments CENP-F führte in mehreren Peptide, darunter eine, die Rückstände 3.031-3 052 enthalten. Massenspektren von diesem CENP-F-Peptid entsprachen Phosphorylierung auf Rückstände, T3042, T3045 und S3048, die sich innerhalb der cNLS (Tabelle 1)10befinden. Massenspektren von einem anderen tryptic Peptid (Rückstände 2.995 3.016) entsprachen Phosphorylierung an S3007 (Tabelle 1)10. Alle vier Cdk1-spezifische Phosphorylierung Standorten wurden auch von der Reihenfolge vorhergesagt. Cdk1-spezifische Substrate enthalten oft eine Prolin neben den Rückstand, der phosphorylierten6, ist, wie für Rückstände, T3042, T3045 und S3007 beobachtet. Es sei darauf hingewiesen, dass S3048 eine etwas ungewöhnliche Cdk1-spezifische Phosphorylierung Website wie eine Phenylalanin sich neben der Serin befindet. Abschließend möchte ich sagen, die Ergebnisse deuten darauf hin, dass CENP-F durch die Kinase Cdk1 speziell auf Rückstände 3.007, 3.042 und 3.045 3.048 phosphoryliert wird. Drei dieser Rückstände befinden sich in der cNLS CENP-F (Tabelle 1), darauf hinweist, dass Cdk1 CENP-F zellulären Lokalisation durch Phosphorylierung des die cNLS in der G2-Phase regulieren kann, wenn Cdk1 active10wird.

Um sicherzustellen, dass diese Cdk1-spezifische Phosphorylierung Seiten eine physiologische Funktion haben, haben wir die Phosphomimetic Variante S3048D10. Phosphomimetic Mutationen imitieren die Wirkung der Phosphorylierung von negativ geladenen Rückstände. Als nächstes reinigen wir die Phosphomimetic Version des Fragments CENP-F, die die cNLS enthalten. Die cNLS CENP-F ist von der nuklearen Transport Rezeptor Karyopherin α, anerkannt und mit hoher Affinität bindet und ist erforderlich für den nuklearen Import CENP-f Um zu testen ob die Phosphomimetic-Mutation die Interaktion zwischen den cNLS CENP-F mit seinen nuklearen Transport Rezeptor Karyopherin α schwächt, führten wir eine verbindliche Assay (Abbildung 3)10. In diesen Experimenten ein gereinigtes CENP-F-Fragment (Wildtyp- oder die S3048D-Variante) war mit gereinigten menschlichen Karyopherin α vermischt und das Gemisch wurde durch analytische Größe Ausgrenzung Chromatographie getrennt. Darüber hinaus wurden die Proteine auch einzeln analysiert. SDS-PAGE-Analyse der Elution Fraktionen ergab, dass das Wildtyp CENP-F Fragment mit der cNLS stark mit Karyopherin α, interagiert, da beide Proteine (Abbildung 3)10ko eluieren. Jedoch nur eine vernachlässigbare Menge des Fragments CENP-F S3048D bindet an Karyopherin α, und diese Proteine eluieren getrennt (Abbildung 3)10. Diese Ergebnisse deuten darauf hin, dass Phosphorylierung von Rückständen 3.048 cNLS CENP-f hätte eine starke Wirkung auf die Interaktion mit den Nukleartransporten Faktor Karyopherin α. Es sei darauf hingewiesen, dass nukleare Import Preise stark abhängig von der Affinität der nuklearen Lokalisierung Signal in Richtung einer nuklearen Transport Faktor46 sind, und daher, es erwartet wird, dass diese Mutationen nuclear Import10verlangsamen.

Figure 1
Abbildung 1: Schematische Darstellung des Cdk1 in-vitro- Kinase Assay. Bitte klicken Sie hier für eine größere Version dieser Figur.

Figure 2
Abbildung 2: CENP-F ist phosphoryliert von Cdk1/cyclin B. (A), Cdk1 spezifische Phosphorylierung Standorte, einen in-vitro- Kinase Assay erfolgte mit gereinigtem CENP-F (Rückstände 2.987 3.065) zu identifizieren. SDS-PAGE-Analyse der Negativkontrolle ohne Cdk1/cyclin B zeigt auf der linken Spur (-Cdk1), neben in-vitro- phosphoryliert CENP-F in der richtigen Spur (+ Cdk1). Molekulargewicht Normen sind angegeben. Beachten Sie die aufwärts Verschiebung der phosphorylierten CENP-F auf SDS-PAGE, die steht im Einklang mit erfolgreichen Phosphorylierung. Cdk1 und cyclin B erscheinen als schwache Streifen 34 kDa und 60 kDa. (B) ESI-Ion Trap Massenspektrometrie der intakten phosphorylierten CENP-F von (A) wurde verwendet, um die Phosphat-Last der intakten phosphorylierten CENP-F (84-Mer) zu bestimmen. Die entsprechenden Massenspektrum wird angezeigt. Die Intensität ist im Vergleich zu den Masse-Ladungs-Verhältnis (m/Z) aufgetragen. Das Spektrum zeigt die + 10 bis + 14 Ladungszustände des intakten CENP-F Fragments nach Phosphorylierung. Sie zeigen eine Art Bevölkerung mit 0, 1, 2, 3 und 4 Phosphat Ester. Um das Verhältnis der einzelnen Arten, Gesamt-Protein-Menge zu quantifizieren, die Peak-Höhen wurden ermittelt und verglichen (Tabelle 1). Diese Zahl wurde von10 geändert und wurde mit freundlicher Genehmigung von Taylor & Francis Herausgeber reproduziert. Bitte klicken Sie hier für eine größere Version dieser Figur.

Figure 3
Abbildung 3: funktionale Verifikation: Phosphomimetic Mutationen von CENP-F stark vermindern die Interaktion mit der nuklearen Transport Rezeptor Karyopherin α. (AF) CENP-F Fragmente (Rückstände 2.987 3.065) gereinigt (0,1 mg) und Karyopherin α (0,7 mg) gereinigt und waren im Molverhältnis 1:1 gemischt und von Größe Ausgrenzung Chromatographie analysiert. Die CENP-F Fragmente und Karyopherin α wurden auch einzeln analysiert. SDS-PAGE-Analyse der Peak Fraktionen wird angezeigt. Elution Bände sind auf der Unterseite (in Schritten von 0,6 mL) angegeben. Auf der linken Seite sind Positionenim kDa Molekulargewicht Marker Bands und ihre Massen angegeben. Ein Sternchen markiert Spuren der verbleibenden GST (Glutathion S-Transferase). (A) Karyopherin α. (B) Elution Profile. Die Absorption bei 280 nm ist im Vergleich zu der Elution Volumen aufgetragen. Die Elution Profil für Karyopherin α (rot) mit Elution Profile von Mischungen aus Karyopherin α mit CENP-F Fragmente überlagert ist (Wildtyp: grün; Phosphomimetic S3048D Mutant: blau). Beachten Sie, dass die Zugabe von Wildtyp CENP-F Fragment der Elution Volumen des Karyopherin α-Peaks zu höheren Masse verschiebt sich die Bindung des CENP-F Wildtyp Fragments entspricht. Diese Verschiebung wird nicht beobachtet, wenn das CENP-F-Fragment mit der Phosphomimetic-Mutation S3048D hinzugefügt wird, was darauf hindeutet, dass die Phosphomimetic Mutation erheblich verringert sich das Zusammenspiel von CENP-F mit Karyopherin α. (C) CENP-F Wildtyp Fragment (wt) und Karyopherin α. (D) CENP-F-wt-Fragment. (E) CENP-F S3048D Fragment und Karyopherin α. (F) CENP-F S3048D fragment. Diese Zahl wurde mit Daten aus10erstellt. Bitte klicken Sie hier für eine größere Version dieser Figur.

Tabelle 1A. Sequenz des Fragments CENP-F (Rückstände 2987-3065) mit vorhergesagt Cdk1-spezifische Phosphorylierung Sites von größeren Schriftgrad hervorgehoben. Tryptic Fragmente sind in Fettdruck hervorgehoben und unterstrichen.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabelle 1 b. Massenspektrometrie-Analyse der intakten CENP-F
84 Mer nach in-vitro- Phosphorylierung mit Cdk1/cyclin B
# der Phosphorylierung Sites (P) erkannt Phosphat-Belastung, ausgedrückt als % der Gesamt-protein
CENP-F 2987-3065 0P 6 %
1 P 37 %
2P 40 %
3P 15 %
4P 3 %
Tabelle 1 Massenspektrometrie-Analyse der Folgen Peptide CENP-f nach in-vitro- Phosphorylierung mit Cdk1/cyclin B
# der Phosphorylierung sites Phosphat-Belastung
Folgen phosphopeptide 0P 57 %
Rückstände 2995-3016 1 P 43 %
Folgen phosphopeptide 0P 7 %
Rückstände 3031-3052 1 P 64 %
2P 29 %
3P 1 %

Tabelle 1: Mass Spectrometry Analyse des Fragments CENP-F nach in-vitro- Phosphorylierung mit Cdk1/cyclin B. Diese Tabelle wurde mit Daten aus10erstellt.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Unsere in-vitro- Kinase Assay ist eine sehr leistungsfähige Methode zur Identifizierung von molekularer Zielstrukturen für die Kinase Cdk1, die eine übergeordnete Steuerung des Zellzyklus und reguliert viele wichtige zelluläre Prozesse. Die Methode bestimmt, ob ein gereinigtes Protein ein Substrat für Cdk1 ist und ermöglicht die Identifizierung von spezifischen Phosphorylierung Websites. Dies erleichtert die mechanistische Studien zur Regulation zellulärer Prozesse durch Phosphorylierung durch Cdk1.

Der kritischste Faktor für erfolgreiche Identifikation der Phosphorylierung Websites durch Massenspektrometrie ist die Phosphorylierung Effizienz der Kinase Assay. Die Effizienz der Phosphorylierung von den einzelnen Standorten sollte so hoch wie möglich, vorzugsweise 100 % betragen. Dies kann durch Erhöhung der Menge an Cdk1/cyclin B und erhöhen die Inkubationszeit bis 16 h. Bei der Berechnung der Höhe der Cdk1/cyclin B benötigt, die molare Konzentration des Proteins und die Anzahl der Phosphorylierung Standorte in Betracht gezogen werden sollte. Dies ist besonders wichtig, wenn mehrere Phosphorylierung-Standorte in das Zielprotein vorhanden sind. Anzumerken ist, dass die Tätigkeit der kommerziellen Cdk1/cyclin B von Charge zu Charge variieren kann, und dass die Kinase Aktivität schnell verlieren kann. Wenn in-vitro- Phosphorylierung nicht erfolgreich ist, empfiehlt es sich, die Aktivität der Kinase testen. Als Positivkontrolle für die Problembehandlung kann in Vitro Phosphorylierung des CENP-F (Rückstände 2.987 3.065) verwendet werden. Als Negativkontrolle sollte eine Reaktion ohne Cdk1/cyclin B Zusatz durchgeführt und analysiert werden. Eine weitere nützliche Negativkontrolle ist die Verwendung von eine Kinase-Toten-Mutante von Cdk1, die aufgrund einer einfachen Punktmutation (D146N)47,48,49katalytisch inaktiv ist. Darüber hinaus kann um identifizierten Phosphorylierung Websites zu überprüfen, eine Phosphonegative Version des Zielproteins erstellt werden wo die Phosphorylierung Websites durch alaninen ersetzt werden. Wenn die identifizierten Phosphorylierung Websites korrekt sind, kann nicht die entsprechenden Phosphonegative-Mutante phosphorylierten in Vitrosein.

Ein einfaches Werkzeug, um erfolgreiche Phosphorylierung des Zielproteins zu erkennen ist die einfache SDS-PAGE Gel Schicht Assay hier beschrieben. Phosphorylierten Proteine Wandern in der Regel langsamer auf SDS-PAGE als ihre unphosphorylated Gegenstücke, aufgrund der Größe und der negativen Ladungen. Beachten Sie, dass für große Proteine, Optimierung der SDS-PAGE-Analyse erforderlich ist, um die Auflösung ausreichend zu visualisieren, die Gel-Schicht zu verbessern. Ein nützliches Werkzeug für die spezifischen Trennung der phosphorylierten Proteine Phosphat-Bindung ist tag (Phos-Tag) SDS-PAGE. Phosphorylierten Proteine in einem Gel mit Phos-Tag Acrylamid zubereitet werden visualisiert, wie langsamer migrieren Bänder im Vergleich mit entsprechenden Proteine50,51rezeptorsignals.

Um qualitativ hochwertige Massenspektren zu erhalten, ist es sehr wichtig, dass das Protein für die in-vitro- Kinase Assay rein und homogen ist. Unsere Reinigung Protokoll erreicht dies durch die Kombination von mehreren hochselektiven Chromatographie-Schritten und durch die Verhinderung Proteinabbau und Oxidation durch die Zugabe von Protease-Inhibitoren und Reduktionsmitteln. Die Reinigung-Protokoll kann geändert werden, um das Protein eluieren von Glutathion (d. h.mit dem GST-Tag intakt); Allerdings ist zu berücksichtigen, dass das GST-Tag eine weitere 25 kDa fügt und große Proteine Ziele für die Massenspektrometrie anspruchsvolle sind. Alternativ unsere Reinigung Protokoll für seine6-Tag Fusionsproteine können auch verwendet werden.

Dieses Protokoll kann auch geändert werden, um Phosphorylierung Websites zu identifizieren, die für andere Kinasen spezifisch sind. Die einzige Voraussetzung ist, dass die gereinigte Kinase verfügbar, aktiven und ausreichend stabil ist. Assay-Bedingungen für jede Kinase Erreichung der maximalen Aktivität angepasst werden müssen. Parameter zur Optimierung werden die Menge der Kinase, Reaktion-Puffer (pH-Wert, Salzgehalt), Inkubationszeit, Reaktionstemperatur und ATP-Konzentration. In-vitro- Kinase-Assays wurden erfolgreich zur Phosphorylierung Standorte für viele Kinasen einschließlich Plks (Polo-Like Kinasen)52,53,54und MAPK/ERK Kinasen (Mitogen-activated protein Kinasen / extrazelluläre Signal-regulierte Kinasen)55,56.

Während die Stärke dieser Methode ist es, spezifische Phosphorylierung Websites in ein gereinigtes Protein identifizieren, sollte angemerkt werden, dass eine Phosphorylierung-Website, die ein Ziel für Cdk1 in Vitro ist nicht unbedingt phosphorylierten in Vivo. In Vivo bestehen zusätzliche regulatorische Mechanismen, die eine Phosphorylierung-Website für die Anerkennung von Cdk1 unzugänglich machen könnte. Z. B. möglicherweise zusätzliche Interaktionspartner anwesend in Vivo, die entweder eine Phosphorylierung Website zu verbergen oder durch strukturelle Veränderungen zugänglich zu machen. Darüber hinaus muss das Substrat mit Cdk1/cyclin B im Zellkern in der G2-Phase colocalize um phosphoryliert werden. Darüber hinaus konnte Post-translationalen Modifikationen oder andere regulatorische Prozesse die Konformation des Ziels Proteins in Vivo, Auswirkungen, die eine Phosphorylierung Website unzugänglich machen könnte. Diese Grenzen können überwunden werden, durch die Gestaltung geeigneter Experimente in Zellen oder Tiermodellen, die überprüfen, ob die identifizierten Phosphorylierung Standorte eine physiologische Funktion haben. Hier verwenden wir eine einfache Bindung-Assay für funktionelle Überprüfung, da Phosphorylierung vermindert das Zusammenspiel von CENP-F mit Karyopherin α. funktionelle Überprüfung sollte auch im Rahmen von Zellen oder einem Tiermodell durchgeführt werden. Daher transfizierten wir auch fluoreszierende Fusionsproteine CENP-F-Fragmente, die die cNLS in HeLa Zellen10enthalten. Phosphomimetic Mutationen innerhalb der cNLS CENP-f vermindert nuklearen Lokalisierung, die eine physiologische Funktion von diesen Phosphorylierung Websites10bestätigt.

Mehrere Tools stehen für funktionale Verifikation der Phosphorylierung Standorte in Zellen oder Tiermodellen. Phosphomimetic Mutationen, die die Auswirkungen der Phosphorylierung von negativen Ladungen zu imitieren, sind für diesen Zweck verbreitet. Für diese wird die Phosphorylierung-Website (Serin oder Threonin) durch Aspartat- oder Glutamat ersetzt. Der Vorteil ist, dass nur eine Punktmutation des Zielproteins erforderlich ist. Es sollte angemerkt werden, dass während Phosphomimetic Mutationen in vielen Fällen für die funktionelle Überprüfung erfolgreich eingesetzt wurden, arbeiten sie vor allem in Fällen, wo kostenlos Änderungen der vorherrschende Faktor für Verordnung, anstatt einen Strukturwandel sind. Phosphomimetic Mutationen nicht imitieren Effekte der Phosphorylierung in vielen anderen Fällen (z.B. 11). Jedoch gibt es andere Ansätze für funktionelle Überprüfung der Phosphorylierung Websites, einschließlich der Verwendung von Phosphonegative Mutationen: diese Mutationen verhindern Phosphorylierung Phosphorylierung Websites durch Alanin ersetzt. Ein weiterer sinnvoller Ansatz für funktionale Verifikation in zellulären Kontext ist der Ausdruck einer Kinase-Toten-Mutante von Cdk1, die durch eine einfache Einführung Punktmutation (D146N)47,48,49inaktiviert wird. Insbesondere sind mehrere kleine Molekül Cdk1 Inhibitoren im Handel erhältlich wie Flavopiridol und RO-3306, die für funktionelle Studien entweder in Zellen oder Tiermodellen7,8,11verwendet werden können. Diese Inhibitoren sind gut charakterisierten, und einige sind in klinischen Studien zur Behandlung von Krebs (für eine Rezension siehe9).

Während eine große Anzahl von Protein Phosphorylierung Websites in Proteomic Studien identifiziert worden, die Kinase-Spezifität ist in den meisten Fällen unbekannt, und die in-vitro- Kinase Assay ist eine der wenigen Methoden zur Verfügung, um Substrate Cdk1 identifizieren. Andere Ansätze wurden auch verwendet. Cdk1 Ziele wurden identifiziert, indem ein veränderter Cdk1 Enzym. Es hat eine größere Substrat bindungstasche und sperrige Versionen von ATP als Substrat6akzeptiert. Diese sperrigen Substrat kann nicht an Wildtyp Kinasen gebunden. Der Zusatz von radioaktiven sperrige ATP auf eine Zelle extrahieren, enthält das modifizierte Cdk1 Enzym führt daher der besonderen Kennzeichnung der direkten Substrate von Cdk1. 200 Cdk1 Ziele wurden in der angehenden Hefe mit dieser Methode; Allerdings kann es für Säugerzellen, angewendet werden, das ist eine entscheidende Einschränkung. In einer weiteren Studie wurden Cdk1 Substrate in menschlichen Gewebekultur Zellen identifiziert, durch quantitative Phosphoproteomics Analyse mit zwei niedermolekularer Hemmer Cdk1, Flavopiridol und RO-3306. 1215 Phosphopeptides auf 551 Proteine wurden bei Cdk1 Inhibitor Zusatz7deutlich reduziert. Diese Methode kann eine gesamte Proteom für potenzielle Cdk1 Ziele Bildschirm, aber was Ziele muss überprüft werden, z.B.durch eine in-vitro- Kinase assay.

In Zukunft wird die in-vitro- Kinase Assay wahrscheinlich mit hohem Durchsatz Bildschirme für Cdk1 Substrate kombiniert werden, die derzeit in der Entwicklungsphase befinden. Aufgrund der großen Anzahl von Cdk1 Substraten in der Proteomforschung wird viele menschliche Cdk1 Substrate müssen noch identifiziert werden, und die in-vitro- Kinase Assay ein wichtiges Instrument zur erkennen, zuordnen und diese Seiten zu überprüfen.

Die in-vitro- Kinase Assay ist ein leistungsfähiges Werkzeug, Ziele für die Kinase Cdk1 identifizieren und spezifische Phosphorylierung Websites zu identifizieren. Identifikation der Phosphorylierung Seiten ermöglicht mechanistische Studien zur Regelung der zelluläre Prozesse durch Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Die Autoren haben nichts preisgeben.

Acknowledgments

Wir danken Dr. David King, Howard Hughes Medical Institute, University of California in Berkeley für Massenspektrometrie Analyse und hilfreichen Kommentare. Wir danken Dr. Xuelian Zhu Shanghai Institutes for Biological Sciences, chinesische Akademie von Wissenschaften, Shanghai, China für die Bereitstellung eines Full-Length CENP-F-Konstrukt. Zu guter Letzt danken wir Dr. Susan Bane, Dr. Brian Callahan und Dr. Christof Grewer an der Binghamton University für den Zugriff auf Geräte. Diese Forschung wurde von der Forschungsgemeinschaft für die State University of New York und der Fakultät für Chemie, State University of New York at Binghamton finanziert.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identifizierung von Cyclin-abhängige Kinase 1 spezifische Phosphorylierung Websites durch eine <em>In-vitro-</em> Kinase Assay
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter