A subscription to JoVE is required to view this content. Sign in or start your free trial.

Method Article

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

16.1K views

DOI:

10.3791/50443

July 16th, 2013

In This Article

Summary

Intercellular Ca2+-waves are driven by gap junction channels and hemichannels. Here, we describe a method to measure intercellular Ca2+-waves in cell monolayers in response to a local single-cell mechanical stimulus and its application to investigate the properties and regulation of gap junction channels and hemichannels.

Abstract

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the brain, liver, retina, cochlea and vasculature. In experimental settings, intercellular Ca2+-waves can be elicited by applying a mechanical stimulus to a single cell. This leads to the release of the intracellular signaling molecules IP3 and Ca2+ that initiate the propagation of the Ca2+-wave concentrically from the mechanically stimulated cell to the neighboring cells. The main molecular pathways that control intercellular Ca2+-wave propagation are provided by gap junction channels through the direct transfer of IP3 and by hemichannels through the release of ATP. Identification and characterization of the properties and regulation of different connexin and pannexin isoforms as gap junction channels and hemichannels are allowed by the quantification of the spread of the intercellular Ca2+-wave, siRNA, and the use of inhibitors of gap junction channels and hemichannels. Here, we describe a method to measure intercellular Ca2+-wave in monolayers of primary corneal endothelial cells loaded with Fluo4-AM in response to a controlled and localized mechanical stimulus provoked by an acute, short-lasting deformation of the cell as a result of touching the cell membrane with a micromanipulator-controlled glass micropipette with a tip diameter of less than 1 μm. We also describe the isolation of primary bovine corneal endothelial cells and its use as model system to assess Cx43-hemichannel activity as the driven force for intercellular Ca2+-waves through the release of ATP. Finally, we discuss the use, advantages, limitations and alternatives of this method in the context of gap junction channel and hemichannel research.

Introduction

Intercellular communication and signaling are essential for the coordination of physiological processes in response to extracellular agonists at the tissue and whole-organ level 1,2 . The most direct way of intercellular communication is created by the occurrence of gap junctions. Gap junctions are plaques of gap junction channels, which are proteinaceous channels formed by the head-to-head docking of two connexin (Cx) hemichannels of adjacent cells 3,4 (Figure 1). Gap junctions allow the passage of small signaling molecules with a molecular weight of less than 1.5 kDa, including Ca2+ or IP3 5, ca....

Access restricted. Please log in or start a trial to view this content.

Protocol

1. Isolation of Corneal Endothelial Cells

Before getting started: Isolate the cells from the fresh eyes, obtained from a local slaughterhouse, as soon as possible after enucleating the eye. Make sure that the eye was enucleated from a cow of maximal 18 months old, five minutes post mortem and preserved in Earle's Balanced Salt Solution - 1% iodine solution at 4 °C for transportation to the laboratory.

  1. Take the eye out of the Earle's Balanced Salt Solution - 1% iodine solution and place it in a Petri dish (100 x 20 mm).
  2. Sterilize the eye with a solution containing 70% ethanol and rinse with Earle's Balanced Salt Sol....

Access restricted. Please log in or start a trial to view this content.

Results

All experiments are executed in compliance with all relevant guidelines, regulations and regulatory agencies and the protocol being demonstrated is performed under the guidance and approval of the animal care and use committee of the KU Leuven.

In bovine corneal endothelial cells (BCEC), functional gap junctions are expressed and both gap junctional intercellular communication and paracrine intercellular communication contribute significantly to intercellular communication in an interactive wa.......

Access restricted. Please log in or start a trial to view this content.

Discussion

In this manuscript, we describe a simple method to measure intercellular Ca2+-wave propagation in monolayers of primary bovine corneal endothelial cells by providing a localized and controlled mechanical stimulation using a micropipette. Mechanically stimulated cells respond with a local increase in intracellular IP3 and Ca2+, both of which are essential intracellular signaling molecules that drive intercellular Ca2+-wave propagation 11,67 . IP3 is directl.......

Access restricted. Please log in or start a trial to view this content.

Disclosures

Authors have nothing to disclose.

Acknowledgements

Research work performed in the laboratory was supported by grants from the Research Foundation - Flanders (FWO; grant numbers G.0545.08 and G.0298.11), the Interuniversity Attraction Poles Program (Belgian Science Policy; grant number P6/28 and P7/13) and is embedded in an FWO-supported research community. CDH is a post-doctoral fellow of the Research Foundation - Flanders (FWO). The authors are very grateful to all current and former members of the Laboratory of Molecular and Cellular Signaling (KU Leuven), Dr. SP Srinivas (Indiana University School of Optometry, USA), the laboratory of Dr. Leybaert (Ghent University) and of Dr. Vinken (VUB) who provided help....

Access restricted. Please log in or start a trial to view this content.

Materials

List of materials used in this article
NameCompanyCatalog NumberComments
Earle's Balanced Salt Solution (EBSS)Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)14155-048
IodineSigma-Aldrich (Deisenhofen, Germany)38060-1EA
Dulbecco's Modified Eagle's Medium (DMEM)Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)11960-044
L-glutamine (Glutamax)Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)35050-038
Amphotericin-BSigma-Aldrich (Deisenhofen, Germany)A2942
Antibiotic-antimycotic mixtureInvitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)15240-096
TrypsinInvitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)25300-054
Dulbecco's PBSInvitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)14190-091
Fluo-4 AMInvitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)F14217
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) Sigma-Aldrich (Deisenhofen, Germany)A265
Apyrase VISigma-Aldrich (Deisenhofen, Germany)A6410
Apyrase VIISigma-Aldrich (Deisenhofen, Germany)A6535
Gap26 (VCYDKSFPISHVR)Custom peptide synthesis
Gap27 (SRPTEKTIFII)Custom peptide synthesis
Control Peptide (SRGGEKNVFIV)Custom peptide synthesis
siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) Annealed siRNA was purchased at Eurogentec (Luik, Belgium)
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)Thermo Electron (Ulm, Germany)
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) Thermo Electron (Ulm, Germany)
Two chambered glass slidesLaboratory-Tek Nunc (Roskilde, Denmark)155380
Confocal microscope Carl Zeiss Meditec (Jena, Germany)LSM510
Piez–lectric crystal nanopositioner (Piezo Flexure NanoPositioner)PI Polytech (Karlsruhe, Germany)P-280
HVPZT-amplifierPI Polytech (Karlsruhe, Germany)E463 HVPZT-amplifier
Glass tubes (glass replacement 3.5 nanoliter)World Precision Instruments, Inc. Sarasota, Florida, USA4878
Micr–lectrode puller Zeitz Instrumente (Munchen, Germany)WZ DMZ-Universal Puller

References

  1. Vinken, M., et al. Connexins and their channels in cell growth and cell death. Cell Signal. 18, 592-600 (2006).
  2. Mese, G., Richard, G., White, T. W. Gap junctions: basic structure and function. J. Invest. Dermatol. 127, 2516-2524 (2007).
  3. Bruzzone, R., White, T.....

Access restricted. Please log in or start a trial to view this content.

Reprints and Permissions

Tags

Gap Junction ChannelsHemichannel ActivityConfocal MicroscopyFluo4-AM LoadingMicromanipulator StimulusATP Release MeasurementConnexin Isoform Analysis