A subscription to JoVE is required to view this content. Sign in or start your free trial.

Method Article

Bioinformatics-based Analyses and B/Th Cell Epitope Prediction of Mugwort Pollen Allergen Art v 1 Protein

792 views

DOI:

10.3791/66517

December 22nd, 2023

* These authors contributed equally

In This Article

Summary

Here, we present a protocol to perform bioinformatics correlation analysis to predict the physicochemical properties, secondary structure, and B and T helper cell epitopes of mugwort pollen main allergen Art v 1 protein to provide a theoretical basis for the subsequent development of artemisia pollen allergic disease vaccine and disease treatment.

Abstract

To analyze the sequence characteristics of mugwort pollen allergen Art v 1 protein and predict its B cell and Th (helper T cell) cell epitopes, the gene sequence and amino acid sequence of Art v 1 protein were obtained by referring to Genebank. ExPASy's Prot Param, TMHMM, DNAstar Protean, Swiss-Model, UCLA-DOE LAB SAVES v6.0, and IEDB were used to analyze and predict physicochemical properties, transmembrane region, secondary structure, tertiary structure, and B cell and Th cell epitopes of the protein.

The Art v 1 protein is composed of 132 amino acid residues, the relative molecular weight is 13404.26, the molecular formula is C584H903N157O181S12, pI value is 7.49, the lipid solubility index is 41.59, and the hydrophilic index is -0.454, which is considered as hydrophilic protein. The instability index (ii) is 78.11, which is classified as an unstable protein. The N-terminus of the protein has an α-helical transmembrane region, which is located in the 5-27 amino acid residue sequence, and the 1-24 position is the signal peptide sequence. There are random coil, β-turn, α-helix, and β-sheet, and it also contains hydrophilic region, flexible region, and surface accessibility region structures.

The prediction results of tertiary structure are consistent with the analysis results of secondary structure. Five dominant B cell epitopes were predicted, which were Art v 1 71-87, Art v 1 33-49, Art v 1 104-120, Art v 1 95-111, and Art v 1 86-102. There were five Th cell dominant epitopes, which were Art v 1 2-16, Art v 1 3-17, Art v 1 4-18, Art v 1 5-19, and Art v 1 6-20. The Art v 1 protein is predicted to have good antigenicity due to the presence of B cell and Th cell epitopes.

Introduction

Mugwort, a genus of Artemisia in Compositae, is widely distributed in Inner Mongolia, Gansu, and other regions of China1. Various allergic diseases induced by mugwort pollen are usually type I allergies caused by the repeated exposure of atopic individuals to pollen allergens and the generation of bioactive mediators, resulting in catarrhal inflammation of nasal mucosa, conjunctiva, and bronchus and even asthma attacks2. The WHO/IUIS Allergen Nomenclatory Subcommittee3 has officially recognized seven mugwort allergens at present, namely, Art v 1-Art v 6 and Art AN 7. Art v 1 protein is one of the main contributors to mugwort pollen allergies. It has a molecular weight of 24-28 kDa and can be recognized by 95% of individuals allergic to mugwort pollen4. It consists of an N-terminal beta-defensin-like domain that is connected to a C-terminal proline-rich tail. Defensins represent endogenous antimicrobial polypeptides that are expressed in several eukaryotes5.

Currently, allergen immunotherapy (AIT) is the only etiologic treatment that can change the natural course of allergic diseases in addition to avoiding exposure to allergens6. The increasing prevalence of allergic diseases over the recent decades underscores the importance of basic and clinical research on allergen molecules and their potential applications in allergy diagnosis and treatment. Many of the allergens used for AIT belong to recombinant proteins, whose physical, chemical, and immunological properties are suitable for the production of allergen vaccines with reduced allergenicity. Therefore, AIT is considered the primary means of effectively preventing and treating allergic diseases, as allergy vaccines are relatively easy to produce at a low cost7. However, vaccine development in the past depended exclusively on molecular biology and immunological experiments. In addition, epitome identification is essential for vaccine development, and the most reliable methods for identification of an epitope are X-ray crystallography and NMR techniques at present; however, they are time-consuming and expensive8. Hence, computational methods and tools, with the advantages of low cost and high speed, were employed to predict epitopes.

This paper describes a bioinformatics correlation analysis method for the prediction of the physicochemical properties, secondary structure, tertiary structure, and B/Th cell epitopes of mugwort pollen main allergen Art v 1 protein. This will provide a theoretical basis for the subsequent development of artemisia pollen allergic disease vaccine and disease treatment.

Access restricted. Please log in or start a trial to view this content.

Protocol

1. Physical and chemical properties of Art v 1 protein

  1. Input AF493943.1 in the GeneBank (Table of Materials) to obtain the amino acid sequence of Art v 1 protein (Supplemental File 1-Supplemental Figure S1).
    NOTE: The Art v 1 protein contains 132 amino acids, which are coded by 624 bp of gene sequences. Its amino acid sequence (AAO24900.1) is MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSG
    KCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYF
    DCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPP
    PPADGGSPPVDGGSPPPPSTH.
  2. Launch the Expasy ProtParam Tool (Table of Materials), inputting the Art v 1 protein amino acid sequence mentioned in step 1.1. Click on the Compute parameters button to display amino acid composition, atomic number, molecular formula, relative molecular weight, positive and negative charge, isoelectric point, and instability index (Supplemental File 1-Supplemental Figure S2).
    NOTE: The instability index is <40 indicating the protein is stable; a value > 40 means the protein is unstable9.

2. Prediction of transmembrane region and signal peptide of Art v 1 protein

  1. Input the above mentioned Art v 1 protein amino acid sequence in the online software TMHMM Server v.2.0 (Table of Materials). Choose Extensive, with graphics as Output format, click on Submit to display membrane structure, and obtain the physical and chemical characteristics of transmembrane protein (Supplemental File 1-Supplemental Figure S3).
  2. Input the above mentioned Art v 1 protein amino acid sequence in the SignaIP5.0 Server online tool (Table of Materials). Choose Eukarya as the Organism group and Long output as the Output format, then, click on Submit and fill in the e-mail address to receive the result of the predicted protein signal peptide (Supplemental File 1-Supplemental Figure S4).

3. Secondary structure prediction of Art v 1 protein

  1. To analyze the hydrophilicity, surface accessibility, flexibility, and antigen index of the Art v 1 protein, input AF493943.1 in GeneBank (Table of Materials), and click on protein id AAO24900.1 | FASTA. Copy the FASTA sequence to the new text file, and modify the file type as FASTA (Supplemental File 1-Supplemental Figure 5). Then, launch the software DNAstar protean module and open the FASTA file to display the secondary structure of Art v 1 protein (Supplemental File 1-Supplemental Figure S6).

4. Tertiary structure prediction and conformation evaluation of Art v 1 protein

  1. To predict the tertiary structure model of Art v 1 protein, input the above mentioned Art v 1 protein amino acid sequence in the Swiss-Model online software (Table of Materials), click on Search For Templates, select the highest similar protein 2kpy.1.A as template, click on Build Models | Model 01, and download the PDB format file (Supplemental File 1-Supplemental Figure S7).
  2. To evaluate the homologous modeling conformation displayed in step 4.1, open the UCLA-DOE LAB SAVES v6.0 online software (Table of Materials), and click on Select file to upload the PDB format file in step 4.1 | Run programs | Procheck | Result | Ramachandran plot (Supplemental File 1-Supplemental Figure S8).

5. Prediction of B cell epitopes of Art v 1 protein

  1. To predict the B cell epitope of Art v 1 protein, open the website of IEDB Analysis Resource online tool (Table of Materials), click on Antigen Sequence Properties, input the above mentioned Art v 1 protein amino acid sequence, and choose the method Bepipred Linear Epitope Prediction 2.0, and finally click on Submit (Supplemental File 1-Supplemental Figure S9).
  2. Open the website of the ABCpred online tool (Table of Materials), input the above mentioned Art v 1 protein amino acid sequence, 0.51 as the threshold, and 16 as the window length to use for prediction, select ON for the overlapping filter, and click on Submit sequence (Supplemental File 1-Supplemental Figure S10).

6. Prediction of Th cell epitopes of Art v 1 protein

  1. To predict the Th cell epitope of Art v 1 protein, open the website of the IEDB Analysis Resource online tool (Table of Materials), click on MHC II Binding, and input the above mentioned Art v 1 protein amino acid sequence. Choose NetMHCllpan 4.1 EL (recommended epitope predictor-2023.09) as the predict method, Human as the species/locus, DRB1*01:01 as HLA-DR, allele, 15 as the length, sort the peptides by Percentile Rank, and click on Submit (Supplemental File 1-Supplemental Figure S11).

Access restricted. Please log in or start a trial to view this content.

Results

ExPASy's Prot Param Tool online software was used for the physiochemical and functional characterization of the protein10. The length of the open text reading frame was 624 bp, encoding 132 amino acids, encoding proteins with a total of 1,837 atoms and a relative molecular weight of 13,404.26. The molecular formula is C584H903N157O181S12, of which the top three amino acids are proline (Pro, 15.9%), alanine (Ala, 12.1%), glycine (Gly, 11.4%), a...

Access restricted. Please log in or start a trial to view this content.

Discussion

Artemisia is one of the most important outdoor allergens in China, and its pollen particles are small, with a diameter of 19-25 µm, which are easily dispersed by wind and produce large amounts of powder. In addition, the severity of allergic symptoms of patients is correlated with the pollen content in the air5. Art v 1 is regarded as the landmark allergen of mugwort pollen allergy, and more than 95% of patients with mugwort allergy are sensitive to Art v 1. In China, ~81% of patients with mu...

Access restricted. Please log in or start a trial to view this content.

Disclosures

The authors have no conflicts of interest to disclose.

Acknowledgements

This work was supported by the Natural Science Foundation of Ningxia (2022AAC03601 and 2023AAC02087) and the Research Foundation of Ningxia Medical University (XM2019052).

Access restricted. Please log in or start a trial to view this content.

Materials

List of materials used in this article
NameCompanyCatalog NumberComments
ABCpredIndraprastha Institute of Information Technology, Indiahttps://webs.iiitd.edu.in/raghava/abcpred/ABC_submission.html
DNAstar Protean softwareDNASTAR, Inc.Version 7.1
Expasy ProtParam ToolSIB Swiss Institute of Bioinformaticshttps://web.expasy.org/protparam/
GeneBankNational Center for Biotechnology Informationhttps://www.ncbi.nlm.nih.gov/nuccore/
IEDB Analysis ResourceNational Institute of Allergy and Infectious Diseaseshttp://www.iedb.org/
SignaIP-5.0 ServerDTU Health Techhttps://services.healthtech.dtu.dk/services/SignalP-5.0/
Swiss-Model online softwareBIOZENTRUMhttps://swissmodel.expasy.org/interactive
TMHMM ServerDTU Health TechVersion 2.0https://services.healthtech.dtu.dk/services/TMHMM-2.0/
UCLA - DOE LAB SAVESUS Department of Energy Office of ScienceVersion 6.0https://saves.mbi.ucla.edu/

References

  1. Liu, D., et al. Recombinant expression of allergen Art la 3.0101 and Art la 3.0102 of Artemisia lavandulaefolia pollen and characteristics of serum specific IgE reactivity. J Clin Dermatol. 49 (07), 398-402 (2020).
  2. Sun, X. Expression, purification and crystallization of Mugwort pollen allergy-associated MHC proteins [D]. , Wuhan Polytechnic University. (2016).
  3. Goodman, R. E., Breiteneder, H. The WHO/IUIS Allergen Nomenclature. Allergy. 74 (3), 429-431 (2019).
  4. Razzera, G., et al. Mapping the interactions between a major pollen allergen and human IgE antibodies. Structure. 18, 1011-1021 (2010).
  5. Zabel, M., et al. Art v 1 IgE epitopes of patients and humanized mice are conformational. J Allergy Clin Immunol. 150 (4), 920-930 (2022).
  6. Peng, G., Han, X. Research progress of specific immunotherapy in atopic dermatitis. J Clin Dermatol. 46 (08), 602-604 (2017).
  7. Gao, Z., et al. Artemisia pollen allergy in China: Component-resolved diagnosis reveals allergic asthma patients have significant multiple allergen sensitization. Allergy. 74, 284-293 (2019).
  8. Sun, P., et al. Bioinformatics resources and tools for conformational B-cell epitope prediction. Comput Math Methods Med. , 943636(2013).
  9. Aqel, A. An integrated multi-pronged reverse vaccinology and biophysical approaches for identification of potential vaccine candidates against Nipah virus. Saudi Pharm J. 31 (12), 101826(2023).
  10. Verma, N. K., Singh, B. Insight from the structural molecular model of cytidylate kinase from Mycobacterium tuberculosis. Bioinformation. 9 (13), 680-684 (2013).
  11. Peters, B., Nielsen, M., Sette, A. T Cell epitope predictions. Annu Rev Immunol. 38, 123-145 (2020).
  12. Andreatta, M., Nielsen, M. Bioinformatics tools for the prediction of T-cell epitopes. Methods Mol Biol. 1785, 269-281 (2018).
  13. Jahn-Schmid, B., et al. Antigen presentation of the immunodominant T-cell epitope of the major mugwort pollen allergen, Art v 1, is associated with the expression of HLA-DRB1 *01. J Allergy Clin Immunol. 115 (2), 399-404 (2005).
  14. Liu, D. Species identification and allergen analysis of Artemisia SPP in northern China [D]. , China Medical University. (2019).
  15. Li, T., Bu, G., Xi, G. Effects of heat treatment on the antigenicity, antigen epitopes, and structural properties of β-conglycinin. Food Chem. 346, 128962(2021).
  16. Li, Y., et al. Bioinformatic prediction of epitopes in the Emy162 antigen of Echinococcus multilocularis. Exp Ther Med. 6, 335-340 (2013).
  17. Qiao, R., et al. Main characteristics and prediction of T-cell epitopes of mite Derp1 protein. Chin J Biologicals. 34 (08), 969-973 (2021).
  18. Ramana, J., Mehla, K. Immunoinformatics and epitope prediction. Methods Mol Biol. 2131, 155-171 (2020).
  19. Ma, F., et al. Advance on prediction methods of B cell antigen epitope. China Animal Husbandry & Veterinary Medicine. 43 (01), 63-67 (2016).
  20. Wang, X., et al. Salidroside, a phenyl ethanol glycoside from Rhodiola crenulata, orchestrates hypoxic mitochondrial dynamics homeostasis by stimulating Sirt1/p53/Drp1 signaling. J Ethnopharmacol. 293, 115278(2022).
  21. Hou, Y., et al. Salidroside intensifies mitochondrial function of CoCl2-damaged HT22 cells by stimulating PI3K-AKT-MAPK signaling pathway. Phytomedicine. 109, 154568(2023).

Access restricted. Please log in or start a trial to view this content.

Reprints and Permissions

Tags

B Cell EpitopeBioinformatics AnalysisProtein Structure PredictionAmino Acid SequencePhysicochemical PropertiesTransmembrane Region
Video Coming Soon