Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identificatie van cycline-afhankelijk Kinase 1 specifieke fosforylatie Sites door een Kinase In Vitro Assay

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Cycline-afhankelijk kinase 1 (Cdk1) wordt geactiveerd in de G2-fase van de celcyclus en regelt veel cellulaire routes. Hier presenteren we een protocol voor een kinase in vitro assay met Cdk1, dat voorziet in de identificatie van Cdk1-specifieke fosforylatie sites vaststelling van cellulaire doelen van deze belangrijke kinase.

Abstract

Cycline-afhankelijk kinase 1 (Cdk1) is een meester-controller voor de celcyclus in alle eukaryoten en kinaseenzym van naar schatting 8-13% van de Proteoom; het aantal vastgestelde doelstellingen voor Cdk1, met name in menselijke cellen is echter nog steeds laag. De identificatie van Cdk1-specifieke fosforylatie sites is belangrijk, aangezien zij mechanistische inzicht verwerven in hoe Cdk1 de celcyclus controleert. Celcyclus verordening is essentieel voor trouwe chromosoom segregatie en gebreken in dit ingewikkelde proces leiden tot chromosoomafwijkingen en kanker.

Hier beschrijven we een in vitro kinase test die wordt gebruikt voor het identificeren van Cdk1-specifieke fosforylatie sites. In deze test, is een gezuiverde eiwit gefosforyleerd in vitro door commercieel beschikbare menselijke Cdk1/cycline B. Successful fosforylatie wordt bevestigd door SDS-PAGE en fosforylering sites worden vervolgens geïdentificeerd door massaspectrometrie. Ook beschrijven we zuivering protocollen die opbrengst zeer zuiver en homogene eiwit preparaten geschikt voor de kinase-bepaling en een bindende bepaling voor de functionele verificatie van de geïdentificeerde fosforylatie sites, die de interactie tussen probes een klassieke nucleaire localisatie signaal (cNLS) en haar nucleair vervoer receptor karyopherin α. Om te helpen met de proefopzet, bekijken we methoden voor de voorspelling van Cdk1-specifieke fosforylatie sites uit proteïne sequenties. Deze protocollen presenteren samen een zeer krachtige aanpak waarmee de opbrengsten Cdk1-specifieke fosforylatie sites en kunnen mechanistisch onderzoek naar hoe Cdk1 de celcyclus controleert. Aangezien deze methode is gebaseerd op zuivere eiwitten, kan het worden toegepast op elk organisme en opbrengsten betrouwbaar modelresultaten, vooral wanneer gecombineerd met functionele studies van de cel.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinases zijn enzymen die overdracht van fosfaat groepen van ATP op substraten en veel cellulaire processen regelen. Deze fosforylatie is omkeerbaar, snel, voegt twee negatieve ladingen, vrije energie worden opgeslagen en is een van de meest voorkomende posttranslationele modificaties gebruikt door cellen. Cdk1, die ook bekend staat als celdeling cyclus eiwit 2 homolog (cdc2) is een meester-controller voor de celcyclus in alle eukaryoten1,2,3,4,5, en kinaseenzym een naar schatting 8-13% van de Proteoom6,7.

Terwijl recente proteomic studies dat veel fosforylatie plaatsen in eiwitten, in de meeste gevallen gebleken is de kinase verantwoordelijk voor deze wijzigingen onbekend. Het aantal bekende Cdk1 doelen, met name in menselijke cellen is laag7. De identificatie van Cdk1-specifieke fosforylatie sites is belangrijk, omdat hierdoor mechanistische studies die stellen hoe Cdk1 controleert de celcyclus. Celcyclus-verordening is belangrijk voor trouwe chromosoom segregatie en celdeling, en een groot aantal cellulaire processen moeten optreden ter ondersteuning van deze belangrijke fysiologische functie. Dit omvat stoppen transcriptie en vertaling vóór het begin van de mitose, evenals een dramatische reorganisatie in cellulaire structuur en organisatie, zoals de demontage van de nucleaire envelop chromosoom condensatie en de mitotische spindel vergadering. Deregulering en fouten in deze processen veroorzaken kanker, aangeboren afwijkingen of mitotische celdood. Specifieke remmers van Cdk1 zoals RO-3306 waren ontwikkelde8, die bieden krachtige hulpprogramma's voor functionele studies, en sommige van deze remmers zijn momenteel in klinische proeven voor de behandeling van kanker (Zie9 voor beoordeling).

Hier beschrijven we een in vitro kinase bepaling die het mogelijk de identificatie van Cdk1-specifieke fosforylatie sites maakt. In deze test, wordt commercieel beschikbare menselijke Cdk1/cycline B gebruikt om een gezuiverde doel eiwit in vitrophosphorylate. Fosforylering van een substraat verhoogt zijn massa en voegt twee negatieve ladingen; Dus, succesvol fosforylatie wordt bevestigd door een opwaartse verschuiving van de band van de gel eiwit op SDS-pagina. Cdk1-specifieke fosforylatie sites worden vervolgens geïdentificeerd door analyse van de Spectrometrie van de massa van het eiwit in vitro phosphorylated. Steun met experimenteel design, bekijken we ook computerhulpmiddelen en referenties voor de voorspelling van Cdk1-specifieke fosforylatie sites van de eiwit-reeks. Daarnaast beschrijven we ook zuivering protocollen die zeer zuiver en homogene eiwit preparaten geschikt voor de kinase assay opleveren. Tot slot, de geïdentificeerde fosforylatie sites moeten worden gecontroleerd door functionele studies, en een eenvoudige bindende test wordt hier beschreven voor dat doel. Gecombineerd, is dit een zeer krachtige aanpak waarmee de opbrengsten Cdk1-specifieke fosforylatie sites en kunnen mechanistisch onderzoek naar hoe Cdk1 de celcyclus7,10,11 controleert. Aangezien deze methode is gebaseerd op zuivere eiwitten, kan het worden toegepast op elk model organisme en opbrengsten betrouwbare resultaten. Functionele controle van de verkregen fosforylatie sites in vitro wordt echter aanbevolen, zoals cellen extra regulerende mechanismen, zoals posttranslationele modificaties, interactie partners of cellulaire lokalisatie op plek hebben die fosforylering sites kan toegankelijk of ontoegankelijk voor erkenning door Cdk1 maken.

Cdk1 herkent een consensus fosforylatie site die uit (Ser/Thr-Pro-X-Lys/Arg), bestaat waarbij X een residu en een serine of threonine de site van fosforylering is. Vooral belangrijk voor erkenning is de aanwezigheid van de proline in de + 1 positie. Bovendien, fundamentele residuen in de + 2 of + 3 posities zijn voorkeur, met de meeste Cdk1-specifieke fosforylatie sites met een Lys of Arg op de + 3 positie6,12.

Activering van Cdk1 strak geregeld is en leidt tot het begin van de mitose1,2,3,4,5. De activiteit van cycline-afhankelijk kinases is in het algemeen afhankelijk van hun associatie met verschillende cyclinen (cycline A, B, C, D en E bij de mens), die op het niveau van de celcyclus13oscillerende zijn uitgedrukt. Cdk1 expressie is constant over de celcyclus en de regulering van de activiteit is afhankelijk van zijn associatie met de regelgevende subeenheden A cycline en cycline B5,13,14,15, als goed als posttranslationele modificaties. Vorming van het B-complex met Cdk1/cycline is vereist voor de kinase activation5,14,15,16,17,18. In de G2-fase, is cycline B vertaald in het cytosol en geïmporteerd in de kern waar het bindt aan de Cdk15,14,15,16,17,18; echter de Cdk1/cycline B geïnactiveerd door fosforylering op residuen van Thr14 en Tyr15 door de menselijke Cdk1-remmende kinases Myt1 (membraan-geassocieerde tyrosine - en threonine-specifieke cdc2-remmende kinase) en Wee1, respectievelijk19, wordt gehouden 20,21. In de late fase van de G2, defosforylerings van Thr14 en Tyr15 door celdeling cyclus 25 fosfatase (cdc25) het kinaseactiviteit van de Cdk1/cycline B complex activeert en triggers van de initiatie van mitose12,14, 18 , 20 , 22 , 23. phosphorylation van Thr161 is ook vereist voor Cdk1/cycline B activering en wordt gemedieerd door Cdk7, de Cdk-activeren kinase (CAK)18. Afbraak van cycline B in anafase inactiveert Cdk1, zodat de uitgang van mitose24,25. Activering van Cdk1/cycline B is dus een ingewikkeld proces. Het protocol hier gepresenteerd wordt uitgevoerd met verkrijgbare Cdk1/cycline B. Tijdens de recombinante uitdrukking van dit complex in insect cellen, het is geactiveerd in vivo door endogene kinases14,20 en blijft actief in de gezuiverde staat. De resulterende actief, recombinante menselijke Cdk1/cycline B is geschikt voor in vitro kinase testen.

Hier beschrijven we een protocol voor de identificatie van Cdk1-specifieke fosforylatie sites in de menselijke centromeer eiwit F (RETOREN-F)10. RETOREN-F is een kinetochoor eiwit dat zich bevindt in de kern gedurende het grootste deel van de interfase (G1 en S-fase) en wordt geëxporteerd naar het cytosol in de G2 fase26,27,28 in een Cdk1-afhankelijke wijze10, 11. nucleaire localisatie wordt verleend door een bipartiete cNLS26. cNLSs worden herkend door de nucleaire vervoer factor karyopherin α, dat, samen met karyopherin β en RanGDP, de invoer van cNLS-cargo in de nucleus29 vergemakkelijkt. Nucleaire export in de G2-fase wordt bevorderd via een onbekende export traject10. Zodra RETOREN-F in het cytosol woont, het wordt gerekruteerd om de nucleaire envelop en op zijn beurt werft de motor eiwit complex dynein30,31. Dit traject is belangrijk om de positie van de respectieve aan de centrosoom kern tijdens de eerste stadia van de mitotische spindel vergadering in een dynein-afhankelijke manier, dat belangrijk voor de juiste timing van de mitotische ingang en voor een fundamentele proces in de hersenen is ontwikkeling30,31,32. Beginnend in de G2-fase, is RETOREN-F ook samengevoegd tot de kinetochoor waar het heeft een belangrijke rol voor trouwe chromosoom segregatie27,28,33,34,35 . Een belangrijke regelgevende stap van deze trajecten is de nucleaire export van RETOREN-F in de G2-fase, die afhankelijk is van Cdk110,11. We beschrijven hier een protocol voor de identificatie van Cdk1-specifieke fosforylatie sites in de cNLS van RETOREN-F. Phosphomimetic mutaties van deze sites is vertragen van nucleaire invoer van RETOREN-F, suggereren dat Cdk1/cycline B direct cellulaire lokalisatie van RETOREN-F door fosforylering van de cNLS10regelt.

Globaal, dit kinase in vitro assay maakt het mogelijk de identificatie van specifieke substraten voor de kinase Cdk1. Purified doel eiwitten gefosforyleerd in vitro door de verkrijgbare Cdk1/cycline B-complex en de fosforylatie sites zijn vervolgens worden geïdentificeerd door de Spectrometrie van de massa. De identificatie van Cdk1-specifieke fosforylatie sites ondersteunt mechanistische studies die onthullen hoe Cdk1 controleert de celcyclus.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. de voorspelling van fosforylering van de Cdk1-specifieke Sites van de eiwit-volgorde

  1. Voordat u begint de kinase-bepaling, de volgorde van de eiwitten voor voorspelde Cdk1-specifieke fosforylatie sites analyseren en de literatuur voor experimenteel gevestigde fosforylatie sites zoeken met onbekende kinase specificiteit. Gebruik de volgende hulpmiddelen, databases en verwijzingen die worden samengevat.
    1. De BGA 3.0 software36,37 (http://gps.biocuckoo.org/online_full.php) gebruiken om te voorspellen Cdk1-specifieke fosforylatie sites in de target eiwit sequentie. Gebruik de link hier voor een uitgebreide voorspelling waarin aantekeningen van secundaire structuur en oppervlakte toegankelijkheid.
    2. Voer in de software, de volgorde van de eiwitten in FASTA formaat. Voor kinase specificiteit, controleren Serine/Threonine kinase, CMGC, CDK, CDC2, CDK1, en uncheck alle andere specifieke kenmerken. Selecteer medium als de drempel en klik op de verzendknop .
    3. De resulterende voorspelde sites met de Cdk1 consensus fosforylatie site (Ser/Thr-Pro-X-Lys/Arg) vergelijken.
    4. Nog belangrijker is, Controleer de voorspelde site voor de proline naast het gefosforyleerd residu (sommige Cdk1 substraten zijn op een minimale site (Ser/Thr-Pro)6,12phosphorylated). Controleer bovendien voor fundamentele residuen, die de voorkeur in de + 2 of + 3 standpunten, met de meeste Cdk1-specifieke fosforylatie sites met een Lys of Arg op de + 3 positie6,12.
  2. Ook controleren of de site toegankelijk voor erkenning, zoals de aanwezigheid van een volledige consensus-site niet voldoende voor Cdk1 fosforylering is.
    1. Inspecteer de oppervlakte toegankelijkheid en secundaire structuur voorspelling aantekening in de BGA-uitvoer, waarin staat of de site wordt voorspeld toegankelijk zijn; N - en C-termini van eiwitten zijn in veel gevallen flexibel en toegankelijk voor fosforylering.
    2. Als een X-ray-structuur van de proteïne van de doelstelling beschikbaar is, toegankelijkheid van vermeende fosforylatie sites te controleren door te inspecteren hun locatie in de structuur.
  3. Zoek de literatuur voor experimenteel gevestigde fosforylatie sites met onbekende kinase specificiteit met behulp van de UniProtKB/Swiss-Prot database38 (http://www.uniprot.org).
    1. Voer de naam in van het eiwit in het zoekvak en klik op de zoekknop . De juiste volgorde hebt geselecteerd. Fosforylering sites zijn geannoteerde en waarnaar wordt verwezen in de sectie aminozuur wijzigingen .
    2. Zoek voor proteomics studies van de mitotische fragmenten van menselijke cel lijnen7,39,40, die vooral nuttig zijn omdat Cdk1 actief in de G2-fase van de celcyclus wordt.
  4. Identificeren bipartiete cNLS door NLSmapper (optioneel).
    Opmerking: Voor eiwitten die shuttle tussen het cytosol en de kern, is een gemeenschappelijk mechanisme voor regulering van cellulaire lokalisatie de fosforylatie van een bipartiete cNLS in de-1 positie van het belangrijkste motief door Cdk1. De fosforylatie schaft nucleaire localisatie van de G2 fase10,41,42,,43.
    1. Voor dergelijke pendelen eiwitten bevatten, door de cNLS in de eiwit-reeks te identificeren door NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). De eiwit sequentie als tekst in het vak volgorde plakken, selecteer een cut-off score van 5.0 en kiezen om te zoeken naar de NLS in de hele regio. Klik op de knop NLS voorspellen .
    2. Vergelijk de resulterende voorspelde cNLS tegen de volgorde van de consensus van een bipartiete cNLS, die uit het kleine motief (Lys-Arg), een linker van ten minste 10 residuen en het belangrijkste motief (Lys-Lys/Arg-X-Lys/Arg) bestaat, waarbij X staat voor elk residu dat niet negatief ten laste .
    3. Controleer als de voorspelde Cdk1 fosforylering site (*) is gelegen grenzend aan de belangrijkste motief in de-1 positie van de linker: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Opmerking: De fosforylatie van een bipartiete cNLS in de positie-1 door Cdk1 werd opgericht als een reguleringsmechanisme voor cellulaire lokalisatie voor verschillende pendelen eiwitten10,41,42, 43.

2. weergave van recombinante eiwitten in Escherichia Coli

  1. Gebruik de expressie plasmiden uit stappen 2.1.1-2.1.2 voor de expressie van recombinante eiwitten in E. coli.
    1. Als u wilt maken het construeren van menselijke expressie van de RETOREN-F (residuen 2,987-3,065), genereren inzetstukken door DNA-fragmenten frequentiebanden te versterken door de polymerase-kettingreactie (PCR) van een full-length RETOREN-F-construct (GenBank toetreding: U19769.1). Gebruik de volgende inleidingen: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG en AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Opmerking: Het volledige menselijke RETOREN-F plasmide werd royaal verzorgd door Dr. X. Zhu, instituten voor biologische wetenschappen, Chinese Academie van Wetenschappen, Shanghai, China.
      1. Kloon de invoegen in de vector pGEX6p1 met de beperkingsplaatsen BamHI en XhoI. Gebruik deze plasmide uitspreken N-terminale glutathione S-transferase (GST) fusion proteïnen van RETOREN-F (residuen 2,987-3,065).
        Opmerking: De GST-tag kan worden cleaved uit door het PreScission protease (voortaan aangeduid als PS protease).
    2. Voor de menselijke karyopherin α expressie construeren, inserts te genereren door het sturen van de fragmenten van DNA door PCR van een full-length karyopherin alpha2 cDNA sjabloon (reeks toetreding NM_002264.3; inleidingen: GCACTACATATGTCCACCAACGAGAATGCTAATA en TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Opmerking: Vanwege de gelijkenis van de isoforms, deze karyopherin alpha2 constructie wordt genoemd in de daaropvolgende tekst karyopherin α.
      1. Kloon de invoegen in de pET28a-pres vector met de beperkingsplaatsen NdeI en XhoI.
        Opmerking: Dit is een vector van de gewijzigde pET28a waarin de reeks codering voor de breukzijde van trombine werd vervangen door een reeks dat voor de breukzijde van een PS-protease codeert. Deze plasmide gebruiken om uit te drukken een fusieproteïne van karyopherin α met een N-terminal zijn-6-tag, waar het zijn6-tag kan worden cleaved uit door PS protease.
  2. Voer om te maken puntmutaties van een doel-eiwit, plaats-geleide mutagenese met een kit.
  3. Express de recombinante eiwitten in E. coli voor verdere zuivering.
    1. Maken van de volgende bestanden: 50 mg/mL kanamycine (1:1, 000 stockoplossing), 35 mg/mL chlooramfenicol in 70% Ethanol (1:1, 000), 100 mg/mL ampicilline (1:1, 000), en 1 M isopropyl β-D-1-thiogalactopyranoside (IPTG; 1:5, 000).
    2. Steriel filter van de voorraden en opgeslagen bij-20 ° C. Vermijd herhaalde bevriezen-ontdooien cycli voor IPTG.
    3. 1 µL van expressie plasmide omvormen met 50 µL van bevoegde cellen van de stam E. coli Rosetta 2 (DE3) pLysS, volgens de instructies van de fabrikant.
    4. Plaat van de cultuur op Luria Bertani (LB) agar met chlooramfenicol (35 µg/mL LB) en ampicilline (100 µg/mL LB) voor de constructie van de RETOREN-F, of chlooramfenicol en kanamycine (50 µg Mo/mL cultuur) voor de karyopherin α construct. Incubeer de platen gedurende 12-20 uur bij 37 ° C.
    5. Kies een één kolonie en LB aangevuld met antibiotica (zie stap 2.3.4) 50 mL beënten. Incubeer de preculture terwijl het schudden bij 160-180 omwentelingen per minuut gedurende 12-20 uur bij 37 ° C.
    6. Bereiden 1 L voor LB medium in een 2800 mL verbijsterd Fernbach kolf. Beide kolven voor elke preculture en de autoclaaf maken hen. Als u wilt toestaan beluchting, vult u de kolven aan meer dan tweederde de maatkolf van volume niet. Conische kolven kunnen ook worden gebruikt.
    7. Antibiotica (stap 2.3.4) en 10 mL van een steriele gefiltreerd 40% (m/v) glucose oplossing per 1 L voor gekoelde pond Voeg toe 20 mL van preculture per 1 liter van LB medium toevoegen.
      Opmerking: De absorptie bij 600 nm van een 1:10 verdunning van de preculture tussen 0.15-0.2 moet.
    8. Incubeer de kolven terwijl het schudden bij 160-180 t/min bij 37 ° C. Meet de extinctie op 600 nm van de bacteriën cultuur regelmatig. Als de extinctie 0,5-0,6 bereikt, induceren eiwit expressie door toevoeging van 0,2 mM IPTG (200 µL van 1 M voorraad per 1 liter van LB medium).
      Opmerking: Het is belangrijk dat cellen op de juiste extinctie veroorzaakt. Meestal duurt het 3-4 h te bereiken dit stadium.
    9. Incubeer de kolven terwijl het schudden gedurende 3 uur bij 37 ° C. Het oogsten van de cellen door middel van centrifugeren (15 min, 4,100 x g, 4 ° C, swing-out rotor). Verwijder het supernatant. Resuspendeer de cel pellets in 20 mL GST-bindende buffer (RETOREN-F) of zijn6-bindende buffer (karyopherin α) per 1 liter van cultuur. Opslaan van de cellen bij-80 ° C.
      1. Bereiden de GST-bindende buffer (10 mM Tris pH 8,0 bij 25 ° C, 150 mM NaCl, 1 mM dithiothreitol (DTT), EDTA 0.5 mM) en zijn6-bindende buffer (10 mM Tris pH 8,0 bij 25 ° C, 250 mM NaCl, 5 mM imidazool pH 8.0, 5 mM β-mercaptoethanol (BMT)) op voorhand.

3. de zuivering van recombinante eiwitten door glutathion-affiniteitchromatografie en Gel filtratie

  1. De volgende bestanden maken: 1 M DTT (1:1, 000 voorraad, steriele gefilterd met 0,2 µM poriegrootte en ontgast); 250 mM phenylmethylsulfonyl fluoride (PMSF; 1:1,000 voorraad in dimethylsulfoxide). Winkel bij-20 ° C. Vermijd het herhaaldelijk bevriezen-ontdooien cycli.
  2. Maak de volgende buffers en hen te koelen tot 4 ° C.
    1. Bereiden de GST-bindende buffer met behulp van 10 mM Tris pH 8,0 bij 25 ° C, 150 mM NaCl, 1 mM DTT, 0.5 mM EDTA.
    2. Bereiden de GST-elutie buffer met behulp van 10 mM gereduceerd glutathion (0,15 g/50 mL) opgelost in een buffer van 50 mM Tris pH 8,0 bij 25 ° C, 150 mM NaCl, 1 mM DTT. Bevestig dat de pH van de buffer die laatste 8.0 is en gebruiken op dezelfde dag die werd gemaakt.
    3. De Gel-filtratie buffer met behulp van 20 mM Tris pH 7.5 bij 25 ° C, 60 mM NaCl, 2 mM DTT voor te bereiden. Steriel filter de buffer met een fles-top-filter (0,2 µM poriëngrootte). Ontgas de buffer al roerend onder vacuüm (-6 psi) gedurende 15 minuten.
    4. DTT toevoegen aan alle bovenstaande buffers op de dag van gebruik.
  3. Ontdooi de cellen van sectie 2, waarin de structuur van de RETOREN-F. Stel het volume aan met de GST-bindende buffer 40 mL. Toevoegen van 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0.5 M stockoplossing, pH 8,0), 7 mg benzamidine hydrochloride (1 mM) en 40 mg D/L methionine.
    Opmerking: Verklein Proteolytische afbraak en voer alle stappen uit bij 4 ° C, bij voorkeur in een koude kamer, tenzij anders vermeld. Houd van cellen, lysates en gezuiverde eiwitfracties op ijs te allen tijde, en proteaseinhibitors toe te voegen. Voeg toe reductants zoals DTT en methionine op de dag van het experiment om oxidatie van cysteïne en methionine residuen. Verklein Proteolytische afbraak en werken via de stappen snel.
  4. Lyse de cellen in een ultrasoonapparaat als volgt. Vul een glas bekerglas met de lysate en dompel het in een waterbad van ijs. Bewerk ultrasone trillingen ten de cultuur (1 min 40 s, bij amplitude/100 W (50%) output, met 10 pulsen van s en 10 s rest cycli). Voeg 250 µM PMSF na ultrasoonapparaat. Inspecteer de cel lysate, die kijken transparanter is en niet langer viskeus.
  5. Duidelijk de lysate door centrifugeren op 12.000-40.000 x g, 25 min, 4 ° C. Gebruik ronde onderkant centrifuge buizen en een vaste hoek rotor.
  6. Uitvoeren evenwichtsinstelling door toevoeging van 2 mL van glutathion agarose 1:1-gier aan een kolom van wegwerp chromatografie. De resulterende kolom moet een volume van 1 mL. Was de kolom met 25 mL ultrazuiver water en 25 mL GST-bindende buffer.
  7. Bindend als volgt uitvoeren. Werken in een koude kamer of koude vak, decanteren in de lysate van de pellets. Filter de lysate (0,2 µm poriegrootte) en giet het op de aangesloten kolom. De kolom van het GLB en het uit te broeden terwijl zachtjes nutating gedurende 30 minuten bij 4 ° C.
  8. Laat de hars regelen, en het verzamelen van de stroom door te wassen de kolom, zet het op een rek. Was de kolom twee keer met 25 mL van GST-bindende buffer.
  9. Elueer door Proteolytische decollete.
    1. Sluit de kolom. Voeg 400 µL van GST-bindende buffer en 250 µL van PS protease (2 mg/mL materieel met een activiteit van 1.000 U/mg, ofwel gezuiverd in het lab of gekocht; Zie Tabel van materialen).
    2. De kolom Cap en zachtjes wervelen om resuspendeer de hars in de buffer. Incubeer de kolommen voor 16-20 h bij 4 ° C. Voeg vervolgens 4 mL GST-bindende buffer elueer de proteolytically gekloofd RETOREN-F-fragment uit de kolom.
  10. Glutathion elutie
    1. Sluit de kolom toevoegen van 4 mL GST-elutie buffer (4 kolom volumes) en incubeer gedurende 10 min naar elueer de afhankelijke GST-tag. Het verzamelen van het eluaat. Regenereren de kolommen voordat het hergebruik zoals beschreven door de fabrikant.
  11. Analyseer de PS protease elutie breuk en de breuk van het glutathion elutie door SDS-PAGE op 16% acrylamide gels. De gels door Coomassie Blue elektroforese 25 V/cm voor 45 min. vlek uitvoeren. De PS protease breuk zal bevatten het gezuiverde RETOREN-F fragment, terwijl de glutathion-fractie zal de gekloofd GST-tag bevatten. Inspecteer de gel om te beoordelen van Proteolytische decollete efficiëntie.
  12. Concentreren de PS protease eluaat tot 0,5 mL centrifugaal filter eenheden met een molecuulgewicht van 3 kDa cutoff (Zie Tabel van materialen). Het eluaat toevoegen in de bovenste compartiment van het filter, en het in stappen van 10-15 min 4 ° C (swing-out rotor) te concentreren het monster 4.100 x g centrifugeren. Meng door pipetteren na elke increment.
  13. Verbinding maken met een geschikt gel filtratie kolom (Zie Tabel van materialen voor aankoopinformatie) naar een systeem van snelle proteïne vloeistofchromatografie (FPLC), en equilibreer het met 1 kolom volume van gel filtratie buffer.
  14. Centrifugeer het geconcentreerde RETOREN-F-fragment in een microcentrifuge (20 min, 21,700 x-g, 4 ° C). Injecteer het monster op de kolom en het Elueer met 1 kolom hoeveelheid gel filtratie buffer. Verzamelen van 0,6 mL breuken.
    Opmerking: De gel filtratie buffer is geoptimaliseerd voor compatibiliteit met de latere kinase-bepaling. Test als de target-proteïne stabiel in deze buffer is. Als er geen stabiele, probeer het toevoegen van meer natriumchloride.
  15. Het analyseren van de piek breuken door SDS-PAGE (stap 3.11). Zwembad de piek breuken die pure RETOREN-F fragmenten bevatten. De gezuiverde RETOREN-F fragmenten concentreren op 3,3 mg/mL (stap 3.12). Analyseer de gezuiverde RETOREN-F fragmenten door SDS-PAGE (stap 3.11).
  16. Eiwit concentratie bepaling
    1. Verdun de monster 1:100 in ultrazuiver water en breng dit in een kwarts micro-cuvette. Record spectra op een golflengtebereik van 220-300 nm in een spectrofotometer.
      Opmerking: Het eiwit concentratie c (mg/mL) is afgeleid van de volgende vergelijking:
      Equation
  17. Maak 50 µL aliquots van het gezuiverde eiwit in 0,5 mL slangen en flash-freeze hen in vloeibare stikstof. Opslaan van de aliquots bij-80 ° C.

4. zuivering van recombinante eiwitten door de chromatografie van de affiniteit van de Ni-NTA

  1. Maak de volgende buffers en afkoelen tot 4 ° C.
    1. Voorbereiding van de zijn6-bindende buffer met behulp van 10 mM Tris pH 8,0 bij 25 ° C, 250 mM NaCl, 5 mM imidazool pH 8.0, 5 mM BME. BME aan alle buffers toevoegen op de dag van gebruik.
    2. Bereiden de zijn6-was buffer op dezelfde manier als het zijn6-bindende buffer maar met behulp van 20 mM imidazool.
    3. Voorbereiding van de zijn6-elutie buffer op dezelfde wijze als de buffer bindende maar met behulp van 150 mM imidazool.
  2. Ontdooien van de cellen van paragraaf 2 waarin de karyopherin α construeren en pas het volume aan 40 mL met zijn6 -bindende buffer. Voeg toe 5 mM BME, 0.250 mM PMSF, 7 mg benzamidine hydrochloride (1 mM) en 40 mg D/L methionine.
    1. Ga verder zoals beschreven in stappen 3.4-3.8 met de volgende varianten: gebruik zijn6-bindende buffer in plaats van GST-bindende buffer voor alle stappen. In plaats van glutathion agarose, gebruik van de nikkel-affiniteit 4 mL (Zie Tabel van materialen) gel om te maken van de kolom, die een kolom volume van 2 mL krijgen.
      Opmerking: Nikkel affiniteit kolommen zijn incompatibel met DTT en EDTA. In plaats van de nikkel affiniteit gel, Ni2 +- nitrilotriacetic zuur (NTA) agarose kan worden gebruikt als de imidazool-concentratie in de elutie-buffer wordt verhoogd tot 250 mM (Zie Tabel van materialen).
  3. Was de kolommen met 8 mL zijn6-was buffer.
  4. Elute de karyopherin-α met 12 mL zijn6-elutie buffer en analyseren van eluaat door SDS-PAGE (stap 3.11).
  5. Voeg toe 250 µL van PS protease (stap 3.9) tot het eluaat en incubeer gedurende 16-20 uur bij 4 ° C. In de tussentijd dialyze het eluaat tweemaal tegen 1 L voor zijn6-bindende buffer voor 2-20 h, met gebruikmaking van een membraan van de dialyse met een 6-8 kDa moleculair gewicht cutoff.
  6. Regenereren de nikkel affiniteit gel kolom zoals beschreven door de fabrikant. De kolom met 25 mL van zijn6equilibreer-bindende buffer. Het dialyzed eiwit toevoegen aan de kolom en de bindende stap uitvoeren, zoals beschreven in stap 3.7.
  7. Verzamelen van de stroom door, waarin het gezuiverde karyopherin α (met zijn6-label gekloofd uit), en het resterende eiwit met een extra 4 mL zijn6Elueer-bindende buffer. Het zwembad van deze fracties. Elueer vervolgens de kolommen met 12 mL zijn6-elutie buffer. Dit gedeelte bevat onzuiverheden.
  8. Analyseren van de uncleaved en gekloofd karyopherin α van stappen 4.4-4.5 en de twee elutie breuken uit deze stap door SDS-PAGE (stap 3.11) evaluatie van de doeltreffendheid van zijn6-label decollete en zuiverheid.
  9. De karyopherin α concentreren te 8 mg/mL en flash-freeze in vloeibare stikstof (stappen 3.15-3.17).

5. in Vitro Kinase-Assay met Cdk1/cycline B

  1. In vitro kinase assay
    Opmerking: Bij aankomst van de kinase, maak kleine porties, flash-freeze ze in vloeibare stikstof en sla ze op-80 ° C. Binnen de 6 maanden gebruiken. Terwijl het molecuulgewicht 34 kDa voor Cdk1 en 48 kDa voor cycline B is is de schijnbare molecuulgewicht van cycline B op SDS-pagina ongeveer 60 kDa.
    1. Voorbereiden van de 10 x PK buffer (meegeleverd met de kinase) met behulp van 0,5 M Tris-HCl, 0,1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0.1% Brij 35, pH 7.5 bij 25 ° C.
    2. De 10 x ATP voorraad bereiden: Maak een oplossing van 4 mM ATP in 1 x PK buffer, en controleer de laatste pH van de voorraad. Opslaan in kleine aliquots bij-20 ° C en Vermijd cycli bevriezen-ontdooien.
    3. Mix 40 µL van RETOREN-F fragment (bij een concentratie van 3,3 mg/mL en 400 µM), 6 µL 10 x PK buffer, 3 µL ultrazuiver water 6 µL ATP 10 x voorraad en 5 µL menselijke Cdk1/cycline B (1 µg, 100 U) in een 0,5 mL microtube.
      Opmerking: Het RETOREN-F fragment heeft een molaire massa van 8.6 kDa en vier Cdk1-specifieke fosforylatie sites. Voor een nieuw substraat, passen de kinase-concentratie in de bepaling volgens de molaire concentratie van het eiwit en volgens het aantal fosforylatie sites. De activiteit van de menselijke recombinante Cdk1/cycline B voorraad is 20.000 U/mL, en de specifieke activiteit is 1.000.000 U / mg. 1 U wordt gedefinieerd als de hoeveelheid Cdk1/cycline B vereist voor het katalyseren van de overdracht van 1 pmol van fosfaat aan Cdk1 peptide substraat PKTPKKAKKL-NH2 (50 µM) in 1 min bij 30 ° C (Zie Tabel van materialen).
    4. Voorbereiden op een reactie van de controle zonder Cdk1/cycline B. Incubate de reacties in een waterbad 1-16 h bij 30 ° C.
  2. Analyseren van 2,5 µL van de kinase assay reactie en 2.5 µL van het besturingselement door SDS-PAGE (stap 3.11), met behulp van een gel met 16% acrylamide. Het vergroten van de resolutie, de lopende tijd uit te breiden.
  3. Voeg een gelijk volume van 6 M guanidine hydrochloride oplossing tot de resterende kinase assay reactie (en naar het besturingselement). De definitieve guanidine hydrochloride concentratie zullen 3 M. deze monsters analyseren door de Spectrometrie van de massa (afdeling 6) identificeren de fosforylatie sites of verzenden van de monsters aan een inrichting massaspectrometrie voor analyse en voer verificatie () functie Sectie 7).
    Opmerking: Bij de analyse van de Spectrometrie van de massa van de latere is het zeer belangrijk dat de efficiëntie van de fosforylering van de afzonderlijke sites zo hoog mogelijk te houden, bij voorkeur 100%, anders de fosforylatie sites kunnen niet worden toegewezen. Sterk verbeteren van fosforylering efficiëntie, toevoegen van grotere hoeveelheden Cdk1/cycline B en vergroten de incubatietijd tot 16 h. De concentratie van ATP kan ook worden verdubbeld.
  4. Voor het oplossen van problemen, door een in vitro kinase bepaling van RETOREN-F (residuen 2,987-3,065) als positieve controle uit te voeren. Gebruik verse batches van Cdk1/cycline B met hoge activiteiten.

6. identificatie van fosforylering van de Cdk1-specifieke Sites door massaspectrometrie

  1. Uitvoeren om te denatureren en desalt de eiwitsteekproeven, microbore omgekeerde fase vloeistofchromatografie met een PLRP300 kolom.
  2. Analyseren met het oog op het aantal fosforylatie sites in de RETOREN-F-fragment, de intact in vitro phosphorylated RETOREN-F 84-mer electrospray ionisatie ion trap massaspectrometrie (ESI-ITMS)44,45.
  3. Om te beoordelen de locatie van de phosphoamino-zuur site van RETOREN-F, phosphorylated bereiden de trypsine digests van de in vitro RETOREN-F EiwitSteekproeven. Desalt de trypsine geklaard met ontzouten Pipetteer tips.
  4. Analyseer de al geklaard van RETOREN-F door electrospray ionisatie Fourier transform ion cyclotron resonantie massaspectrometrie (ESI-FTICR MS). Analyses uit te voeren op een massaspectrometer ESI-FTICR met een tijd van de accumulatie van 169 µs.
    Opmerking: De nauwkeurigheid van de massa's bepaald door ESI-FTICR MS is binnen 0,005 amu. Om te kwantificeren van de verhouding van elke respectieve tot het bedrag van de totale proteïne gefosforyleerd soort, de piekhoogte van de massaspectra.

7. functionele verificatie: Testen van de effecten van Phosphomimetic mutaties op eiwit-eiwitinteractie door analytische Size Exclusion Chromatography

Opmerking: voor verificatie van de functionele van de geïdentificeerde Cdk1-specifieke fosforylatie sites, phosphomimetic mutanten van RETOREN-F fragmenten werden gemaakt door vervanging van de geïdentificeerde fosforylatie sites met aspartates. De negatieve lading van aspartaat bootst de effecten van fosforylering. Een mutant S3048D van het RETOREN-F fragment (residuen 2,987-3,065) werd opgericht.

  1. Voor functionele controle, de binding van wild-type vergelijken en phosphomimetic RETOREN-F fragmenten te karyopherin α. gebruik een analytische gel filtratie als de bindende bepaling. Voor de filtratie van analytische gel, RETOREN-F fragmenten te zuiveren door chromatografie van de affiniteit van glutathion (stappen 3.1-3.12), en de gel filtratie stap overslaan.
  2. Concentreren op het eiwit tot 5-6 mg/mL. Flash-freeze eiwit aliquots in vloeibare stikstof (stappen 3.15-3.17).
  3. Mix de gezuiverde RETOREN-F fragmenten (0.1 mg, wild-type of de S3048D-variant) en gezuiverd karyopherin α (0.7 mg) in een molaire verhouding van 1:1. Stel het monstervolume tot 200 µL met gel filtratie buffer. Incubeer het monster gedurende 30 minuten op ijs, monster (0,2 µm poriegrootte) filteren en schakel het monster door middel van centrifugeren (25 min, 21,700 x-g, 4 ° C)
  4. Scheid de monster door grootte uitsluiting chromatografie (stappen 3.13-3.14). Gebruik een gel filtratie buffer bestaande uit 20 mM HEPES, pH 7.5, 150 mM NaCl, en 2 mM DTT. De analytische gel filtratie-experimenten onder identieke omstandigheden voor alle monsters uit te voeren.
  5. Kalibreer de analytische gel filtratie kolom met molecuulgewicht normen van bekende molaire massa zoals beschreven door de fabrikant.
  6. Analyseren van de elutie breuken met 16% SDS-pagina (stap 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

We hebben onlangs een in vitro kinase assay (Figuur 1) gebruikt ter identificatie van de Cdk1-specifieke fosforylatie sites in een fragment van de RETOREN-F die deel uitmaakt van een cNLS10. Dit signaal verleent nucleaire localisatie van RETOREN-F gedurende het grootste deel van de interfase. In de G2-fase, wordt RETOREN-F geëxporteerd van de kern naar het cytosol in een Cdk1-afhankelijke manier. Met het oog op een mechanistische inzichten over hoe Cdk1 cellulaire lokalisatie van RETOREN-F regelt, analyseren we de volgorde van de RETOREN-F om te voorspellen Cdk1-specifieke fosforylatie sites, met de BGA server36,37. Binnen de cNLS van RETOREN-F, drie Cdk1-specifieke fosforylatie sites waren voorspeld op residuen 3,042, 3045, en 3,048 (tabel 1). Een andere Cdk1-specifieke fosforylatie site was ook voorspeld voor residu 3,007 (tabel 1)10. Daarom, hypothetische we dat Cdk1 RETOREN-F lokalisatie rechtstreeks door fosforylering van de cNLS regelt.

Om te testen of de cNLS van RETOREN-F een substraat voor Cdk1 is, wij uitgevoerd een in vitro kinase assay met het gezuiverde menselijke RETOREN-F fragment (residuen 2,987-3,065) en menselijke Cdk1/cycline B. In vitro phosphorylated RETOREN-F werd geanalyseerd op 16% SDS-pagina, samen met een negatieve controle dat ontbrak de kinase Cdk1 (figuur 2A)10. Voor phosphorylated in vitro RETOREN-F, wordt een duidelijke opwaartse verschuiving waargenomen voor de band op de gel in vergelijking met de negatieve controle. Dit is typisch van gefosforyleerd eiwitten als elke fosfaatgroep twee negatieve ladingen en extra massa voegt. Deze resultaten suggereren dat RETOREN-F is phosphorylated door Cdk1/cycline B-10.

Om te bepalen van het aantal RETOREN-F fosforylatie sites en te kwantificeren van de efficiëntie van de fosforylatie van deze sites, werd het intact in vitro phosphorylated RETOREN-F fragment (84-mer) geanalyseerd door de Spectrometrie van de massa (ESI-ITMS)10. De waargenomen ESI-ion trap massaspectrum (figuur 2B) suggereert dat het intact RETOREN-F-fragment is phosphorylated op vier locaties (tabel 1)10.

De locatie van de sites van gefosforyleerd aminozuur in de opeenvolging van RETOREN-F werd beoordeeld door onderzoek al geklaard door ESI-FTICR MS. trypsine cleaves eiwit ketens na lysines en arginines, en een samenvatting van de Trypsine van het fragment van de RETOREN-F resulteerde in verschillende peptides, waaronder één die residuen 3,031-3, 052. Massaspectra van deze RETOREN-F-peptide waren consistent met fosforylatie op residuen, T3042, T3045 en S3048, die zich bevinden binnen de cNLS (tabel 1)10. Massaspectra van een ander al peptide (residuen 2,995-3,016) waren consistent met fosforylatie op S3007 (tabel 1)10. Alle vier Cdk1-specifieke fosforylatie sites werden ook voorspeld op grond van de volgorde. Cdk1-specifieke substraten bevatten vaak een proline naast het residu dat gefosforyleerd6, waargenomen residuen van T3042, T3045 en S3007. Opgemerkt moet worden dat S3048 een ietwat ongewone Cdk1-specifieke fosforylatie site is, zoals een fenylalanine is gelegen naast de serine. Tot slot suggereren de resultaten dat RETOREN-F is specifiek phosphorylated op residuen, 3,007, 3,042, 3,045 en 3,048 door de kinase Cdk1. Drie van deze residuen bevinden zich binnen de cNLS van RETOREN-F (tabel 1), die aangeeft dat de Cdk1 RETOREN-F cellulaire lokalisatie via fosforylering van de cNLS in de G2-fase, wanneer Cdk1 active10 wordtkan regelen.

Om te verifiëren dat deze Cdk1-specifieke fosforylatie sites een fysiologische functie hebben, hebben we de phosphomimetic variant S3048D10. Phosphomimetic mutaties nabootsen van de effecten van fosforylering door negatief geladen residuen. Vervolgens gezuiverd we de phosphomimetic versie van het RETOREN-F-fragment die deel uitmaakt van de cNLS. De cNLS van RETOREN-F wordt herkend door de nucleaire vervoer receptor karyopherin α, die bindt met hoge affiniteit en is vereist voor nucleaire invoer van RETOREN-F. Om te testen of de phosphomimetic mutatie de interactie tussen de cNLS van RETOREN-F met zijn nucleaire vervoer receptor karyopherin α verzwakt, wij uitgevoerd een bindende assay (Figuur 3)10. In deze experimenten, een gezuiverde RETOREN-F-fragment (het wild-type of de S3048D-variant) werd gemengd met gezuiverde menselijke karyopherin α en het mengsel werd gescheiden door analytische grootte uitsluiting chromatografie. Daarnaast is de eiwitten ook individueel werden geanalyseerd. SDS-pagina-analyse van de elutie breuken bleek dat het wild-type RETOREN-F-fragment met de cNLS sterk met karyopherin α, communiceert aangezien beide eiwitten Elueer Co (Figuur 3)10. Echter, slechts een te verwaarlozen bedrag van het fragment van de RETOREN-F S3048D bindt aan karyopherin α, en deze proteïnen Elueer afzonderlijk (Figuur 3)10. Deze resultaten suggereren dat fosforylatie van residu 3,048 van de cNLS van RETOREN-F zou een sterk effect hebben op de interactie met het nucleair vervoer factor karyopherin α. Opgemerkt moet worden dat nucleaire import tarieven sterk afhankelijk van de affiniteit van een nucleaire localisatie signaal naar een nucleair vervoer factor46 zijn, en dus de verwachting is dat deze mutaties nucleaire importeren10vertragen.

Figure 1
Figuur 1: schematische weergave van de Cdk1 in vitro kinase assay. Klik hier voor een grotere versie van dit cijfer.

Figure 2
Figuur 2: RETOREN-F is phosphorylated door Cdk1/cycline B. (A) om te identificeren Cdk1 specifieke fosforylatie sites, een kinase in vitro assay werd uitgevoerd met gezuiverde RETOREN-F (residuen 2,987-3,065). SDS-pagina analyse van een negatieve controle zonder Cdk1/cycline B wordt weergegeven in de linker rijstrook (-Cdk1), naast in vitro phosphorylated RETOREN-F in de juiste rijstrook (+ Cdk1). Moleculair gewicht normen worden aangegeven. Opmerking de opwaartse verschuiving van gefosforyleerd RETOREN-F op SDS-pagina, die strookt met de succesvolle fosforylering. Cdk1 en cycline B weergegeven als vage balken 34 kDa en 60 kDa. (B) ESI-ion trap massaspectrometrie voor intact gefosforyleerd RETOREN-F van (A) werd gebruikt voor het bepalen van de fosfaat belasting van de intact gefosforyleerd RETOREN-F (84-mer). De overeenkomstige massaspectrum wordt weergegeven. De intensiteit is uitgezet tegen de verhouding van de massa-naar-charge (m/z). Het spectrum toont de + 10 + 14 gratis Staten van het fragment RETOREN-F intact na fosforylering. Zij geven een soort bevolking met 0, 1, 2, 3 en 4 fosfaatesters. Om te kwantificeren van de verhouding van elke soort die zullen totaal eiwit bedrag, de piekhoogten werden vastgesteld en vergeleken (tabel 1). Dit cijfer is gewijzigd van10 en werd gereproduceerd met toestemming door Taylor and Francis Uitgever. Klik hier voor een grotere versie van dit cijfer.

Figure 3
Figuur 3: functionele verificatie: phosphomimetic mutaties van RETOREN-F sterk verminderen de interactie met het nucleair vervoer receptor karyopherin α. (A--F) Gezuiverd RETOREN-F fragmenten (residuen 2,987-3,065) (0,1 mg) en gezuiverd karyopherin α (0.7 mg) en werden gemengd in molaire 1:1 verhouding en geanalyseerd door grootte uitsluiting chromatografie. De RETOREN-F fragmenten en karyopherin α werden ook afzonderlijk geanalyseerd. SDS-pagina analyse van breuken van de piek is gebleken. Elutie volumes worden aangegeven op de bodem (in stappen van 0,6 mL). Aan de linkerkant, worden posities van moleculair gewicht marker bands en hun massa's in kDa aangegeven. Een sterretje gemarkeerd sporen van residuele GST (glutathione S-transferase). (A) Karyopherin α. (B) elutie profielen. De absorptie bij 280 nm is uitgezet tegen het elutievolume. Het profiel van de elutie voor karyopherin α (rood) is bedekt met elutie profielen van mengsels van karyopherin α met RETOREN-F fragmenten (wild-type: green; phosphomimetic S3048D mutant: blauw). Merk op dat toevoeging van het wild-type RETOREN-F fragment verschuift het elutievolume van de karyopherin α piek naar hogere massa, die in overeenstemming met de binding van het fragment van de wild-type RETOREN-F is. Deze verschuiving is niet waargenomen wanneer het fragment van de RETOREN-F met de phosphomimetic mutatie S3048D wordt toegevoegd, wat suggereert dat de phosphomimetic mutatie sterk de interactie van RETOREN-F met karyopherin α. (C) RETOREN-F wild-type fragment (wt vermindert) en karyopherin α. (D) RETOREN-F wt fragment. (E) RETOREN-F S3048D fragment en karyopherin α. (F) RETOREN-F S3048D fragment. Dit cijfer is gemaakt met gegevens uit10. Klik hier voor een grotere versie van dit cijfer.

Tabel 1A. Volgorde van het fragment van de RETOREN-F (residuen 2987-3065) met voorspelde Cdk1-specifieke fosforylatie sites gemarkeerd door grotere tekengrootte. Al fragmenten worden onderstreept en gemarkeerd in vet.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabel 1B. Analyse van de Spectrometrie van de massa van de intact RETOREN-F
84 mer na in vitro fosforylatie met Cdk1/cycline B
# van fosforylering sites (P) gedetecteerd Fosfaat belasting uitgedrukt als % van totale eiwitten
RETOREN-F 2987-3065 0P 6%
1 P 37%
2P 40%
3P 15%
4P 3%
Tabel 1C. Analyse van de Spectrometrie van de massa van al peptides van RETOREN-F na in vitro fosforylatie met Cdk1/cycline B
# van fosforylering sites Fosfaat belasting
Al phosphopeptide, 0P 57%
residuen 2995-3016 1 P 43%
Al phosphopeptide, 0P 7%
residuen 3031-3052 1 P 64%
2P 29%
3P 1%

Tabel 1: Massa spectrometrie van de analyse van het RETOREN-F fragment na in vitro fosforylatie met Cdk1/cycline B. Deze tabel is gemaakt met gegevens uit10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Onze kinase in vitro assay is een zeer krachtige methode om het identificeren van moleculaire targets voor de kinase Cdk1, die een hoofdbesturing van de celcyclus en regelt veel belangrijke cellulaire processen. De methode wordt bepaald of een gezuiverde proteïne een substraat voor Cdk1 is en identificatie van specifieke fosforylatie sites kunt. Dit vergemakkelijkt het mechanistische studies voor de regulatie van cellulaire processen door fosforylering via Cdk1.

De meest kritische factor voor succesvolle identificatie van de sites van fosforylering door Spectrometrie van de massa is de efficiëntie van de fosforylering van de kinase-bepaling. De efficiëntie van de fosforylering van de afzonderlijke sites moet zo hoog mogelijk te houden, bij voorkeur 100%. Dit kan worden bereikt door verhoging van het bedrag van Cdk1/cycline B en verhoging van de incubatietijd tot 16 h. Bij de berekening van het bedrag van de Cdk1/cycline B nodig, de molaire concentratie van het eiwit en het aantal fosforylatie sites moeten worden beschouwd. Dit is vooral belangrijk als meerdere fosforylatie sites aanwezig in de target-eiwit zijn. Ook opgemerkt moet worden dat de activiteit van de commerciële Cdk1/cycline B van charges kan variëren, en dat de kinase activiteit snel kan verliezen. Als in vitro fosforylatie mislukt, is het aanbevolen om het testen van de activiteit van de kinase. Als positieve controle voor het oplossen van problemen, kan in vitro fosforylatie van RETOREN-F (residuen 2,987-3,065) worden gebruikt. Als een negatieve controle, moet een reactie zonder Cdk1/cycline B toevoeging worden uitgevoerd en geanalyseerd. Een ander nuttig negatieve controle is het gebruik van een mutant kinase-dood van Cdk1, die, als gevolg van een eenvoudig punt Mutatie (D146N)47,48,49, catalytically inactief is. Bovendien, om te controleren of de geïdentificeerde fosforylatie sites, kan een phosphonegative versie van het target-eiwit worden gemaakt, waar de fosforylatie sites zijn vervangen door alanines. Als de geïdentificeerde fosforylatie sites juist zijn, kan de corresponderende phosphonegative mutant gefosforyleerd in vitroniet.

Een eenvoudige tool om het detecteren van succesvolle fosforylering van het eiwit doel is de eenvoudige SDS-pagina gel shift assay hier beschreven. Gefosforyleerd meestal migreren de proteïnen langzamer op SDS-pagina dan hun unphosphorylated tegenhangers, als gevolg van de toegevoegde grootte en de negatieve ladingen. Merk op dat voor grote eiwitten, optimalisatie van de SDS-pagina-analyse is vereist om de resolutie voldoende te visualiseren van de verschuiving van de gel. Een nuttig instrument voor de specifieke scheiding van gefosforyleerd eiwitten is fosfaat-bindende tag (Phos-tag) SDS-pagina. Gefosforyleerd eiwitten in een bereid met Phos-tag acrylamide gel worden gevisualiseerd als langzamer migreren bands in vergelijking met overeenkomstige gedefosforyleerd eiwitten50,51.

Voor het verkrijgen van hoge kwaliteit massaspectra, is het zeer belangrijk dat het eiwit voor de kinase in vitro assay zuiver en homogeen is. Ons protocol zuivering bereikt dit door het combineren van verschillende zeer selectief chromatografie stappen en door te voorkomen dat de aantasting van het eiwit en oxidatie door de toevoeging van proteaseinhibitors en reductants. Het protocol van de zuivering kan worden aangepast voor het eiwit Elueer door glutathion (dat wil zeggen, met de GST-tag intact); het moet echter worden overwogen de GST-tag voegt een ander 25 kDa, waardoor grote eiwitten zijn uitdagende doelstellingen voor massaspectrometrie. U kunt ook onze zuivering protocol voor zijn6-label fusion eiwitten kunnen ook worden gebruikt.

Dit protocol kan ook worden aangepast om identificatie van fosforylering sites die specifiek voor andere kinases zijn. De enige vereiste is dat de gezuiverde kinase beschikbaar, actieve en voldoende stabiel. Assay voorwaarden moeten worden aangepast voor elke kinase te bereiken van de maximale activiteit. Parameters voor het optimaliseren van opnemen het bedrag van de kinase, de reactie buffer (pH, zoute concentratie) incubatietijd, reactie temperatuur en ATP concentratie. In vitro kinase testen zijn met succes gebruikt om identificatie van fosforylering sites voor vele kinases met inbegrip van Plks (polo-achtige kinases)52,53,,54, en MAPK/ERK kinases (mitogeen-geactiveerd proteïne kinases / extracellulaire-signaal-gereglementeerde kinases)55,,56.

Terwijl de kracht van deze methode is het identificeren van specifieke fosforylatie sites in een gezuiverde proteïne, opgemerkt moet worden dat een fosforylatie-site die is een doelwit voor Cdk1 in vitro gefosforyleerd in vivoniet noodzakelijk kan zijn. In vivo, extra regulerende mechanismen zijn ingebouwd, waardoor een fosforylatie site ontoegankelijk voor erkenning door Cdk1. Bijvoorbeeld extra interactie partners mogelijk aanwezig in vivo, die kon verbergen een fosforylatie site of toegankelijk via structurele veranderingen te maken. Bovendien moet het substraat colocalize met Cdk1/cycline B in de kern in de G2-fase te worden phosphorylated. Bovendien, kon posttranslationele modificaties of andere regelgevende processen beïnvloeden de gedaante van de target eiwit in vivo, waardoor een fosforylatie site ontoegankelijk. Deze beperkingen kunnen worden weggenomen door het ontwerpen van passende experimenten in cellen of dierlijke modellen die verifiëren dat de geïdentificeerde fosforylatie sites een fysiologische functie hebben. Hier gebruiken we een eenvoudige binding assay voor functionele controle, aangezien fosforylatie vermindert de interactie van RETOREN-F met karyopherin α. functionele controle ook moet worden uitgevoerd in het kader van cellen of een dierlijk model. Dus transfected wij ook fluorescerende fusion proteïnen van RETOREN-F-fragmenten, die deel uitmaakt van de cNLS in HeLa cellen10. Phosphomimetic mutaties binnen de cNLS van RETOREN-F afgenomen nucleaire localisatie, die een fysiologische functie van deze fosforylatie sites10bevestigd.

Er zijn verschillende hulpprogramma's voor functionele keuring van fosforylering sites in cellen of dierlijke modellen beschikbaar. Phosphomimetic mutaties, die het nabootsen van de effecten van fosforylering door negatieve ladingen, worden veel gebruikt voor dit doel. Voor deze, wordt de site van fosforylering (serine of threonine) vervangen door aspartaat of glutamaat. Het voordeel is dat alleen een punt mutatie van het target-eiwit nodig is. Opgemerkt moet worden, dat terwijl phosphomimetic mutaties werden met succes gebruikt in veel gevallen voor functionele controle, ze vooral werken in gevallen waar gratis wijzigingen de overheersende Inzender voor de verordening in plaats van een structurele wijziging zijn. Phosphomimetic mutaties niet na te bootsen effecten van fosforylering in veel andere gevallen (b.v., 11). Andere benaderingen zijn echter beschikbaar voor functionele controle van fosforylering sites, met inbegrip van het gebruik van phosphonegative mutaties: deze mutaties voorkomen fosforylering door vervanging van fosforylering sites met alanine. Een andere nuttige benadering voor functionele keuring in cellulaire context is de uitdrukking van een mutant kinase-dood van Cdk1, die wordt geïnactiveerd door een gemakkelijk-aan-introduceren punt Mutatie (D146N)47,48,49. Met name zijn verscheidene kleine molecuul Cdk1 remmers commercieel verkrijgbaar zoals Flavopiridol en RO-3306, die kan worden gebruikt voor functionele studies in cellen of diermodellen7,8,11. Deze remmers zijn goed gekarakteriseerd, en verschillende klinische proeven voor de behandeling van kanker (voor een overzicht Zie9).

Terwijl een groot aantal proteïne fosforylatie sites zijn geïdentificeerd in proteomic studies, de specificiteit kinase is in de meeste gevallen onbekend, en de kinase in vitro assay is een van de paar methoden beschikbaar voor het identificeren van substraten voor Cdk1. Andere benaderingen zijn ook gebruikt. Cdk1 doelstellingen werden geïdentificeerd met behulp van een gemanipuleerde Cdk1-enzym. Het heeft een grotere substraat bindende zak en meer volumineuze versies van ATP als een substraat6accepteert. Dit omvangrijke substraat binden niet aan wild-type kinases. De toevoeging van radiolabeled omvangrijk ATP naar een cel uittreksel bevattende het gewijzigde Cdk1 enzym daarom leidt tot de specifieke etikettering van de directe substraten voor Cdk1. 200 Cdk1 doelstellingen werden geïdentificeerd in de ontluikende gist met deze methode; worden echter, het kan niet toegepast op cellen van zoogdieren, die is een belangrijke beperking. In een andere studie, werden Cdk1 substraten in menselijk weefsel cultuur cellen geïdentificeerd door het uitvoeren van kwantitatieve Fosfoproteomics analyse met behulp van twee klein molecuul remmers van Cdk1, Flavopiridol en RO-3306. 1215 phosphopeptides op 551 eiwitten werden aanzienlijk verlaagd bij toevoeging7van de Inhibitor van de omwenteling van de Cdk1. Deze methode kan het scherm van een hele Proteoom voor Cdk1 doelwit, maar als gevolg doelstellingen moeten worden geverifieerd, bijvoorbeelddoor een kinase in vitro assay.

De kinase in vitro assay zullen in de toekomst waarschijnlijk worden gecombineerd met hoge doorvoersnelheid schermen voor Cdk1 substraten die momenteel in ontwikkeling. Vanwege het grote aantal Cdk1 substraten in het proteoom, zal vele menselijke Cdk1 verschillende ondergronden moeten nog worden geïdentificeerd, en de kinase in vitro assay een belangrijk instrument om te identificeren, kaart, en controleer of deze sites.

De kinase in vitro assay is een krachtig hulpmiddel te identificeren van doelstellingen voor de kinase Cdk1 en te identificeren specifieke fosforylatie sites. Identificatie van deze sites fosforylatie kan mechanistische studies voor de regulatie van cellulaire processen door Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

De auteurs hebben niets te onthullen.

Acknowledgments

Wij danken Dr. David King, Howard Hughes Medical Institute, University of California in Berkeley voor spectrometrische analyse en nuttige opmerkingen. Wij danken Dr. Xuelian Zhu, Shanghai, instituten voor biologische wetenschappen, Chinese Academie van Wetenschappen, Shanghai, China voor het verstrekken van een full-length RETOREN-F-constructie. Tot slot bedanken wij Dr. Susan Bane, Dr. Brian Callahan en Dr. Christof Grewer aan de Binghamton University voor toegang tot apparatuur. Dit onderzoek werd gefinancierd door de Research Foundation voor de State University of New York en het departement chemie, State University of New York at Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identificatie van cycline-afhankelijk Kinase 1 specifieke fosforylatie Sites door een Kinase <em>In Vitro</em> Assay
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter