Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identifikasjon av Cyclin-avhengige Kinase 1 bestemt fosforylering områder av en In Vitro Kinase analysen

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Cyclin-avhengige kinase 1 (Cdk1) er aktivert i G2 fase av cellen syklus og regulerer mange mobilnettet baner. Her presenterer vi en protokoll for i vitro kinase analysen med Cdk1, som gjør identifisering av Cdk1-spesifikke fosforylering områder for å etablere mobilnettet mål for denne viktige kinase.

Abstract

Cyclin-avhengige kinase 1 (Cdk1) er en mester kontroller for cellen syklusen i alle eukaryoter og phosphorylates anslagsvis 8-13% av proteom; men er antall identifiserte mål for Cdk1, spesielt i menneskeceller fortsatt lav. Identifikasjon av Cdk1-spesifikke fosforylering områder er viktig som de gir mekanistisk innsikt i hvordan Cdk1 styrer cellen syklus. Cellen syklus regulering er avgjørende for trofast kromosom segregering mangler i denne kompliserte prosessen fører til chromosomal avvik og kreft.

Her beskriver vi en i vitro kinase analyse som brukes til å identifisere Cdk1-spesifikke fosforylering områder. I denne analysen, en renset protein er fosforylert i vitro av kommersielt tilgjengelige menneskelige Cdk1/cyclin B. vellykket fosforylering er bekreftet av SDS side og fosforylering nettsteder identifiseres senere massespektrometri. Vi beskriver også rensing protokoller som gir svært ren og homogen protein forberedelser for kinase analysen, og en bindende analysen identifiserte fosforylering nettsteder, som sonder samspillet mellom funksjonell bekreftes et klassisk kjernefysiske lokalisering signal (cNLS) og dens kjernefysiske transport reseptoren karyopherin α. For å hjelpe med eksperimentell design, vi går gjennom metoder for prediksjon av Cdk1-spesifikke fosforylering områder fra protein sekvenser. Sammen gir disse protokollene en svært kraftig metode som gir Cdk1-spesifikke fosforylering områder og aktiverer mekanistisk studier i hvordan Cdk1 styrer cellen syklus. Siden denne metoden er avhengig av renset proteiner, kan den brukes på modellen organismen og gir pålitelig resultat, spesielt kombinert med cellen funksjonelle studier.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinaser er enzymer som overføre fosfat grupper fra ATP på underlag og regulere mange cellulære prosesser. Denne fosforylering reversibel, rask, legger to negative kostnader, og lagrer fri energi og er en av de vanligste posttranslational modifikasjonene brukes av celler. Cdk1, som kalles også cellen divisjon syklus protein 2 homolog (cdc2) er en mester kontroller for cellen syklusen i alle eukaryoter1,2,3,4,5, og phosphorylates en anslagsvis 8-13% av proteom6,7.

Mens proteomic studier har identifisert mange fosforylering nettsteder i proteiner, oftest er kinase ansvarlig for disse endringene ukjent. Antall kjente Cdk1 mål, spesielt i menneskeceller er lav7. Identifikasjon av Cdk1-spesifikke fosforylering områder er viktig, ettersom mekanistisk studier som etablerer hvordan Cdk1 styrer cellen syklus. Cellen syklus regulering er viktig for trofast kromosom segregering og celledeling, og et mylder av cellulære prosesser må skje for å støtte denne viktige fysiologiske funksjon. Dette inkluderer stanse transkripsjon og oversettelse før utbruddet av mitose, samt en dramatisk omorganisering i cellestruktur og organisasjon, for eksempel demontering av kjernefysiske konvolutten, kromosom kondens og mitotisk spindelen montering. Dereguleringen og feil i prosessene føre til kreft, fødsel defekter eller mitotisk celledød. Bestemt hemmere av Cdk1 som RO-3306 var utviklet8, som gir kraftige verktøy for funksjonell studier, og noen av disse hemmere finnes i kliniske studier for kreftbehandling (se9 for gjennomgang).

Her beskriver vi i vitro kinase analysen som gjør identifisering av Cdk1-spesifikke fosforylering områder. I denne analysen, tilgjengelige menneskelige Cdk1/cyclin B til å phosphorylate en renset målet protein i vitro. Fosforylering av et øker sin masse og legger to negative kostnader; Derfor er vellykket fosforylering bekreftet av et skift oppover i protein gel bandet på SDS-siden. Cdk1-spesifikk fosforylering nettsteder identifiseres senere massespektrometri analyse av proteinet i vitro fosforylert. For å hjelpe med eksperimentell design, se vi også beregningsorientert verktøy og referanser for prediksjon av Cdk1-spesifikke fosforylering områder fra protein sekvensen. I tillegg beskriver vi også rensing protokoller som gir svært rent og homogen protein forberedelser egnet for kinase analysen. Endelig identifisert fosforylering nettstedene må verifiseres av funksjonelle studier, og en enkel binding analysen er beskrevet her for dette formålet. Kombinert, er dette en svært kraftig tilnærming som gir Cdk1-spesifikke fosforylering områder og aktiverer mekanistisk studier i hvordan Cdk1 styrer celle syklus7,10,11. Siden denne metoden er avhengig av renset proteiner, kan det brukes på alle modell organismen og gir pålitelige resultater. Men funksjonell bekreftelse for innhentet fosforylering nettsteder vitro anbefales celler har ytterligere regulatoriske mekanismer sted, for eksempel posttranslational modifikasjoner, samhandling partnere eller mobilnettet lokalisering som kan gjøre fosforylering nettsteder tilgjengelige eller utilgjengelige for anerkjennelse av Cdk1.

Cdk1 gjenkjenner en konsensus fosforylering område som består av (Ser/Thr-Pro-X-Lys/Arg), der X er noen rester og en serine eller threonin er stedet for fosforylering. Spesielt viktig for anerkjennelse er tilstedeværelsen av proline i posisjon 1. I tillegg grunnleggende rester er foretrukket i 2 eller 3 posisjoner, med de fleste Cdk1-spesifikke fosforylering områder som inneholder et Lys eller Arg på 3 posisjon6,12.

Aktivering av Cdk1 er strengt regulert og fører til utbruddet av mitose,1,,2,,3,,4,,5. Aktiviteten til cyclin-avhengige kinaser er generelt avhengig av tilknytningen forskjellige cyclins (cyclin A, B, C, D og E hos mennesker), som er uttrykt ved oscillerende nivåer gjennom cellen syklus13. Cdk1 uttrykk er konstant over cellen syklus og regulering av sin aktivitet er avhengig av tilknytningen til de regulatoriske underenheter cyclin A og cyclin B5,13,14,15, som samt post-translasjonell endringer. Dannelse av Cdk1/cyclin B komplekset er nødvendig for kinase aktivisering5,14,15,16,17,18. Den G2 fasen, er cyclin B oversatt i stoffer og importert til kjernen der det binder seg til Cdk15,14,15,16,17,18; men holdes Cdk1/cyclin B deaktivert ved fosforylering på rester Thr14 og Tyr15 av de menneskelige Cdk1-hemmende kinaser Myt1 (membran-assosiert tyrosin - og threonin-spesifikk cdc2-hemmende kinase) og Wee1, henholdsvis19, 20,21. I slutten G2 fase, dephosphorylation Thr14 og Tyr15 av cellen divisjon syklus 25 fosfatase (cdc25) aktiverer kinase aktiviteten til Cdk1/cyclin B-komplekset og utløser initiering av mitose12,14, 18 , 20 , 22 , 23. fosforylering i Thr161 er også nødvendig for Cdk1/cyclin B aktivisering og er formidlet av Cdk7, Cdk-aktivere kinase (CAK)18. Nedbrytning av cyclin B i anaphase deaktiverer Cdk1, slik at exit fra mitose24,25. Aktivering av Cdk1/cyclin B er derfor en komplisert prosess. Protokollen presenteres her er utført med kommersielt tilgjengelige Cdk1/cyclin B. Under rekombinant uttrykk for dette komplekset i insekt celler, det er aktivert i vivo av endogene kinaser14,20 og forblir aktiv i renset staten. Den resulterende aktive, rekombinant menneskelige Cdk1/cyclin B er egnet for i vitro kinase analyser.

Her beskriver vi en protokoll for identifisering av Cdk1-spesifikke fosforylering områder i menneskelig centromere protein F (CENP-F)10. CENP-F er en kinetochore protein som finnes i kjernen under mesteparten av interphase (G1 og S-fase) og eksporteres til stoffer i G2 fase26,27,28 i en Cdk1-avhengige måte10, 11. kjernefysiske lokalisering er gitt av en bipartite cNLS26. cNLSs gjenkjennes av kjernefysiske transport faktor karyopherin α, som letter, karyopherin β og RanGDP, import av cNLS-Last i kjernen29. Kjernefysisk eksport i G2 fase muliggjøres via en ukjent eksport veien10. Når CENP-F ligger i stoffer, det er rekruttert til den kjernefysiske konvolutten og rekrutterer igjen motor protein kompleks dynein30,31. Denne veien er viktig å plassere kjernen respektive til centrosome under innledende stadier av mitotisk spindelen montering i en dynein-avhengige måte, som er viktig for riktig tidspunkt mitotisk posten og en grunnleggende prosess i hjernen utvikling30,31,32. Starter i G2 fase, er CENP-F også samlet inn i kinetochore der det er viktige roller for trofast kromosom segregering27,28,33,34,35 . Et viktige forskrifter skritt av disse er kjernefysiske eksport av CENP-F i G2 fase, som er avhengig av Cdk110,11. Vi beskriver her en protokoll for identifisering av Cdk1-spesifikke fosforylering områder i cNLS av CENP-F. Phosphomimetic mutasjoner av disse nettstedene tregere kjernefysiske import av CENP-F, antyder at Cdk1/cyclin B direkte regulerer mobilnettet lokalisering av CENP-F ved fosforylering i sin cNLS10.

Samlet gjør denne i vitro kinase analysen identifikasjon av bestemte underlag for kinase Cdk1. Purified målet proteiner er fosforylert i vitro kommersielt tilgjengelige Cdk1/cyclin B komplekset og webområdene fosforylering identifiseres senere av massespektrometri. Identifikasjon av Cdk1-spesifikke fosforylering områder støtter mekanistisk studier som viser hvordan Cdk1 styrer cellen syklus.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. prediksjon av Cdk1-spesifikke fosforylering nettsteder fra Protein sekvensen

  1. Før analysen kinase, analysere protein sekvens for predikerte Cdk1-spesifikke fosforylering områder og søke litteraturen for eksperimentelt etablerte fosforylering nettsteder med ukjent kinase spesifisitet. Bruk av følgende verktøy, databaser og referanser som summeres.
    1. Bruke IGPer 3.0 programvare36,37 (http://gps.biocuckoo.org/online_full.php) for å forutsi Cdk1-spesifikke fosforylering områder i målet protein sekvensen. Bruke linken her for en omfattende prediksjon som inneholder merknader sekundær og overflate tilgjengelighet.
    2. Angi protein rekkefølgen FASTA format i programmet. Kinase spesifisitet, sjekk Serine/threonin kinase, CMGC, CDK, CDC2, CDK1og uncheck alle andre særegenheter. Velg medium som grensen og klikk Send -knappen.
    3. Sammenligne resulterende spådd områdene med Cdk1 konsensus fosforylering området (Ser/Thr-Pro-X-Lys/Arg).
    4. Viktigere, sjekk spådd området for proline ved phosphorylated rester (noen Cdk1 underlag er fosforylert på et minimalt område (Ser/Thr-Pro)6,-12). I tillegg kontrollere grunnleggende rester, som er foretrukket i 2 eller 3 posisjoner, med de fleste Cdk1-spesifikke fosforylering områder som inneholder et Lys eller Arg på de 3 posisjon6,12.
  2. Også sjekke at området er tilgjengelig etter tilstedeværelsen av en full konsensus nettsted er ikke nok for Cdk1 fosforylering.
    1. Kontroller overflaten tilgjengelighet og sekundær prediksjon merknad i IGPer utdata, som sier om nettstedet er spådd til å bli tilgjengelig; N - og C-termini proteiner er i mange tilfeller fleksible og tilgjengelige for fosforylering.
    2. Hvis målet struktur en X-ray tilgjengelig, sjekk tilgjengelighet av antatte fosforylering nettsteder ved å undersøke deres plassering i strukturen.
  3. Søk litteraturen for eksperimentelt etablerte fosforylering nettsteder med ukjent kinase spesifisitet bruker UniProtKB/Swiss-beskytte databasen38 (http://www.uniprot.org).
    1. Angi navnet på protein i søkeboksen og klikk Søk -knappen. Velg oppføringen riktig rekkefølge. Fosforylering nettsteder er merket og refereres til i delen aminosyre modifikasjoner .
    2. Søk etter Proteomikk studier av mitotisk ekstrakter av human celle linjer7,39,40, som er spesielt nyttig fordi Cdk1 blir aktiv i G2 fase av cellen syklus.
  4. Identifisere bipartite cNLS av NLSmapper (valgfritt).
    Merk: For proteiner som mellom stoffer og kjernen, er en vanlig mekanisme for regulering av mobilnettet lokalisering fosforylering i en bipartite cNLS i-1 posisjon av store motivet av Cdk1. Fosforylering opphever kjernefysiske lokalisering i G2 fase10,41,42,43.
    1. For slike skytteltrafikk proteiner, identifisere cNLS i protein sekvensen ved NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Innliming protein sekvensen som tekst i rekkefølge-boksen, Velg cut-off poengsummen 5.0 og velge å søke etter NLS i hele regionen. Klikk Forutsi NLS .
    2. Sammenligne den resulterende anslått cNLS mot konsensus sekvensen av en bipartite cNLS, som består av små motivet (Lys-Arg), et linker av minst 10 rester og store motivet (Lys-Lys/Arg-X-Lys/Arg), der X er noen rester som ikke belastes negativt .
    3. Sjekk Hvis anslått Cdk1 fosforylering området (*) ligger ved det store motivet-1 plasseringen av linker: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Merk: Fosforylering i en bipartite cNLS i-1 posisjon ved Cdk1 ble etablert som en regulerende mekanisme for mobilnettet lokalisering for flere skytteltrafikk proteiner10,41,42, 43.

2. uttrykk for rekombinante proteinene i Escherichia Coli

  1. Bruke uttrykk plasmider fra trinn 2.1.1-2.1.2 for uttrykket av rekombinante proteinene i E. coli.
    1. For å opprette den menneskelige CENP-F (rester 2,987-3,065) uttrykket konstruere, generere setter inn ved å forsterke DNA fragmenter av polymerasekjedereaksjons (PCR) fra en full lengde CENP-F-konstruksjon (GenBank tiltredelse: U19769.1). Bruk følgende primerne: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG og AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Merk: Den fulle menneskelige CENP-F plasmider ble sjenerøst gitt av Dr. X. Zhu, institutter for biologiske basalfag, kinesiske vitenskapsakademi, Shanghai, Kina.
      1. Klone sette inn pGEX6p1 vektor med de BamHI og XhoI begrensning. Bruk denne plasmider uttrykke N-terminal glutation S-transferase (GST) fusion proteiner av CENP-F (rester 2,987-3,065).
        Merk: GST-koden kan være kløyvde av av den PreScission protease (heretter referert til som PS protease).
    2. For den menneskelige karyopherin î± uttrykk konstruere, generere setter inn ved å forsterke DNA fragmenter av PCR fra full lengde karyopherin α2 cDNA mal (sekvens tiltredelse NM_002264.3; primere: GCACTACATATGTCCACCAACGAGAATGCTAATA og TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Merk: På grunn av likheten av isoformene, denne karyopherin α2 konstruksjonen som kalles i den påfølgende teksten karyopherin α.
      1. Klone innsatsen i pET28a-pres vektor med de NdeI og XhoI begrensning.
        Merk: Dette er en modifisert pET28a vektor der rekkefølgen kodingen for trombin cleavage området ble erstattet av en sekvens som koder for et PS protease cleavage område. Bruk denne plasmider for å uttrykke en fusion protein av karyopherin î± med en N-terminal hans6-kode, der den hans6-kode kan være kløyvde av av PS protease.
  2. For å opprette punkt mutasjoner av et mål protein, utføre området-regisserte mutagenese en Kit.
  3. Uttrykke rekombinante proteinene i E. coli for påfølgende rensing.
    1. Gjør følgende aksjer: 50 mg/mL kanamycin (1:1, 000 lagerløsning), 35 mg/mL chloramphenicol 70% etanol (1:1, 000), 100 mg/mL ampicillin (1:1, 000) og 1 M isopropyl β-D-1-thiogalactopyranoside (IPTG, 1:5, 000).
    2. Sterile filtrere aksjer og lagre på 20 ° C. Unngå gjentatte fryse-Tin sykluser for IPTG.
    3. Forvandle 1 µL av uttrykket plasmider 50 µL av kompetente celler av E. coli Rosetta 2 (DE3) pLysS belastningen, i henhold til produsentens instruksjoner.
    4. Plate kulturen på Luria-Bertani (LB) agar med chloramphenicol (35 µg/mL LB) og ampicillin (100 µg/mL LB) for CENP-F konstruksjonen eller chloramphenicol og kanamycin (50 µg/mL kultur) for den karyopherin î± konstruere. Inkuber platene 12-20 h på 37 ° C.
    5. Velg en enkelt koloni og vaksinere 50 mL av LB supplert med antibiotika (se trinn 2.3.4). Inkuber preculture mens riste på 160-180 rpm for 12-20 h på 37 ° C.
    6. Forberede 1 L av LB medium i en 2800 mL forbløffet Fernbach kolbe. Gjøre to flasker for hver preculture og autoklav dem. Hvis lufting, ikke fyll flasker til mer enn to tredjedeler kolbe volumet. Erlenmeyer flasker kan brukes også.
    7. Legge til antibiotika (trinn 2.3.4) og 10 mL av en steril-filtrert 40% (w/v) glukose løsning per 1 L avkjølt lb legge til 20 mL preculture per 1 L LB medium.
      Merk: Absorbansen på 600 nm i en 1:10 fortynning av preculture bør være mellom 0,15-0.2.
    8. Ruge på flasker mens riste på 160-180 rpm på 37 ° C. Måle absorbansen på 600 nm bakterier kultur regelmessig. Hvis absorbansen når 0,5-0.6, indusere protein uttrykk ved å legge 0.2 mM IPTG (200 µL av 1 M lager per 1 L LB medium).
      Merk: Det er viktig at cellene er indusert på riktig absorbansen. Det tar vanligvis 3-4 h til dette stadiet.
    9. Ruge på flasker mens risting for 3t på 37 ° C. Høste celler med sentrifugering (15 min, 4,100 x g, 4 ° C, swing-out rotoren). Kast nedbryting. Resuspend celle pellets i 20 mL GST-bindende buffer (CENP-F) eller hans6-binding buffer (karyopherin α) per 1 L kultur. Lagre cellene på-80 ° C.
      1. Forberede GST-bindende bufferen (10 mM Tris pH 8.0 ved 25 ° C, 150 mM NaCl, 1 mM dithiothreitol (DTT), 0,5 mM EDTA) og hans6-bindende buffer (10 mM Tris pH 8.0 ved 25 ° C, 250 mM NaCl, 5 mM Imidazole pH 8.0, 5 mM β-mercaptoethanol (BME)) på forhånd.

3. rensing av rekombinant Protein av glutation affinitet kromatografi og Gel filtrering

  1. Gjør følgende aksjer: 1 M DTT (1:1, 000 lager, sterile filtrert med 0,2 µM porestørrelse, og degassed); 250 mM phenylmethylsulfonyl fluor (PMSF, 1:1,000 aksjer i dimethylsulfoxide). Butikken på 20 ° C. Unngå gjentatte fryse-Tin sykluser.
  2. Gjør følgende bufferne og avkjøle dem til 4 ° C.
    1. Forberede GST-bindende buffer med 10 mM Tris pH 8.0 ved 25 ° C, 150 mM NaCl, 1 mM DTT, 0,5 mM EDTA.
    2. Forberede GST - elueringsbufferen med 10 mM redusert glutation (0.15 g/50 mL) oppløst i en buffer med 50 mM Tris pH 8.0 ved 25 ° C, 150 mM NaCl, 1 mM DTT. Bekrefte at pH i siste bufferen er 8.0 og bruke samme dag ble.
    3. Forberede Gel-filtrering buffer med 20 mM Tris pH 7.5 ved 25 ° C, 60 mM NaCl, 2 mM DTT. Sterile filtrere bufferen med en plastflaske-top filter (0,2 µM porestørrelse). Degas bufferen stirring under vakuum (-6 psi) i 15 min.
    4. Legge til DTT i alle over buffere ved bruk.
  3. Tine cellene fra del 2 som inneholder den CENP-F konstruere. Juster volumet til 40 mL med GST-bindende bufferen. Legge 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0,5 M lagerløsning, pH 8.0) 7 mg benzamidine hydroklorid (1 mM) og 40 mg D/L metionin.
    Merk: Redusere proteolytisk fornedrelse, utføre alle trinnene på 4 ° C, fortrinnsvis i en kjølerom, med mindre annet er angitt. Holde celler, lysates og renset protein fraksjoner på is til alle tider, og legge proteasehemmere. For å hindre oksidasjon av cystein og metionin rester, Legg reductants som DTT og metionin på dagen for eksperimentet. For å redusere proteolytisk fornedrelse, går du gjennom trinnene på raskt.
  4. Lyse cellene i en sonicator som følger. Fyll et glass beaker med den lysate og dyppe den i en isen vannbad. Sonicate kultur (1 min 40 s, på 100 W (50%) utgang/amplitude, med 10 s pulser og 10 s resten sykluser). Legge til 250 µM PMSF etter sonication. Inspisere cellen lysate, som bør se mer gjennomsiktig og ikke lenger være tyktflytende.
  5. Klart det lysate av sentrifugering på 12.000-40,000 x g, 25 min, 4 ° C. Bruk runde bunn sentrifuge rør og en fast vinkel rotor.
  6. Utføre balanse ved å legge 2 mL glutation agarose 1:1 slurry til en engangs kromatografi kolonne. Den resulterende kolonnen vil har 1 mL. Vask kolonnen med 25 mL ultrapure vann og 25 mL GST-bindende bufferen.
  7. Utføre bindende som følger. Arbeider i en kjølerom eller kaldt, Dekanter lysate fra pellets. Filtrere lysate (0,2 µm porestørrelse) og helle den på kolonnen plugget. Cap kolonnen og ruge det mens forsiktig nutating i 30 min på 4 ° C.
  8. Å vaske la kolonnen, sette den på et stativ, harpiks avgjøre, og samle flyten gjennom. Vask kolonnen to ganger med 25 mL GST-bindende bufferen.
  9. Elute av proteolytisk cleavage.
    1. Koble kolonnen. Legge til 400 µL GST-bindende bufferen og 250 µL av PS protease (2 mg/mL lager med en aktivitet på 1000 U/mg, enten renset i laboratoriet eller kjøpt, se Tabellen for materiale).
    2. Cap kolonnen og forsiktig virvel for å resuspend harpiks i bufferen. Inkuber kolonnene for 16-20 h på 4 ° C. Deretter Legg 4 mL GST-bindende buffer elute proteolytically cleaved CENP-F fragmentet kolonnen.
  10. Glutation elueringsrør
    1. Koble kolonnen Legg 4 mL GST-elueringsbufferen (4 kolonne volumer) og ruge for 10 min å elute bundet GST-koden. Samle på eluate. Generere kolonnene før gjenbruk som beskrevet av produsenten.
  11. Analysere PS protease elueringsrør brøken og glutation elueringsrør brøkdel av SDS side på 16% akrylamid gels. Utføre geleelektroforese på 25 V/cm for 45 min. flekken geléer Coomassie Blue. PS protease brøken inneholder renset CENP-F fragmentet, mens glutation brøken inneholder cleaved GST-koden. Inspisere gel å vurdere proteolytisk cleavage effektivitet.
  12. Konsentrere PS protease eluate til 0,5 mL ved hjelp av sentrifugal filter enheter med en 3 kDa molekylvekt cutoff (se Tabell for materiale). Legg til eluate i øvre rommet filter, og sentrifuge det i 10-15 min intervaller på 4100 x g, 4 ° C (swing-out rotoren) å konsentrere prøven. Bland ved pipettering etter hver økning.
  13. Koble en egnet gel filtrering kolonne (se Tabell for materiale for kjøpsinformasjon) til en rask protein flytende kromatografi (FPLC) system, og equilibrate det med 1 kolonne volum gel filtrering bufferen.
  14. Sentrifuge konsentrert CENP-F fragmentet i en microcentrifuge (20 min, 21,700 x g, 4 ° C). Sett inn prøven på kolonnen og elute det med 1 kolonne volum gel filtrering bufferen. Samle 0,6 mL fraksjoner.
    Merk: Gel filtrering bufferen er optimalisert for kompatibilitet med påfølgende kinase analysen. Test hvis målet proteinet er stabil i bufferen. Hvis det ikke er stabil, prøve å legge mer natriumklorid.
  15. Analysere peak fraksjoner av SDS-side (trinn 3.11). Basseng peak fraksjoner som inneholder ren CENP-F fragmenter. Konsentrere renset CENP-F fragmenter til 3,3 mg/mL (trinn 3.12). Analysere renset CENP-F fragmenter av SDS-side (trinn 3.11).
  16. Protein konsentrasjon besluttsomhet
    1. Fortynne eksempel 1: 100 i ultrapure vann og legg den i kvarts mikro-søppel. Registrere spectra på en bølgelengde rekke 220-300 nm i et spektrofotometer.
      Merk: Protein konsentrasjon c (mg/mL) er avledet fra denne formelen:
      Equation
  17. Gjøre 50 µL dele renset protein i 0,5 mL microtubes og flash-fryse dem i flytende nitrogen. Lagre dele på-80 ° C.

4. rensing av rekombinant Protein av Ni-NTA affinitet kromatografi

  1. Gjør følgende bufferne og avkjøles til 4 ° C.
    1. Forberede den hans6-binding buffer med 10 mM Tris pH 8.0 ved 25 ° C, 250 mM NaCl, 5 mM Imidazole pH 8.0, 5 mM BME. Legge til BME alle buffere ved bruk.
    2. Forberede den hans6-vaskebuffer på samme måte som hans6-bindende buffer men bruker 20 mM Imidazole.
    3. Forberede den hans6-elueringsbufferen på samme måte som bindende bufferen men bruker 150 mM Imidazole.
  2. Tine cellene fra del 2 som inneholder karyopherin î± konstruere og juster volumet til 40 mL med sin6 -binding buffer. Legge til 5 mM BME, 0.250 mM PMSF, 7 mg benzamidine hydroklorid (1 mM) og 40 mg D/L metionin.
    1. Gå frem som beskrevet i trinn 3.4-3.8 med følgende varianter: bruker hans6-binding buffer i stedet for GST-bindende bufferen for alle trinnene. I stedet for glutation agarose, bruke 4 mL av nikkel affinitet gel (se Tabell for materiale) for å gjøre kolonnen som vil har kolonne 2 mL.
      Merk: Nikkel affinitet kolonner er uforenlig med DTT og EDTA. I stedet for nikkel affinitet gel, Ni2 +- nitrilotriacetic syre (NTA) agarose kan brukes, hvis imidazole konsentrasjonen i elueringsbufferen er økt til 250 mM (se Tabell for materiale).
  3. Vask den kolonner med 8 mL av hans6-vaskebuffer.
  4. Elute karyopherin-α med 12 mL av hans6-elueringsrør buffer og analysere eluate SDS-side (trinn 3.11).
  5. Legge til 250 µL av PS protease (trinn 3.9) å eluate og Inkuber 16-20 h på 4 ° C. I mellomtiden dialyze eluate to ganger mot 1 L hans6-binding bufferen for 2-20 h, med en dialyse membran med en 6-8 kDa molekylvekt cutoff.
  6. Generere kolonnen nikkel affinitet gel som beskrevet av produsenten. Equilibrate kolonnen med 25 mL av hans6-binding buffer. Legg dialyzed protein til kolonnen og utfører bindende trinn som beskrevet i trinn 3.7.
  7. Samle flyten gjennom, som inneholder den renset karyopherin î± (med sin6-tag kløyvde av), og elute gjenværende protein med en ekstra 4 mL av hans6-binding buffer. Basseng disse fraksjoner. Deretter elute kolonnene med 12 mL av hans6-elueringsbufferen. Denne fraksjonen inneholder urenheter.
  8. Analysere uncleaved og kløyvde karyopherin î± fra trinn 4.4-4.5 og to elueringsrør fraksjoner dette trinnet SDS-side (trinn 3.11) å vurdere effektiviteten av hans6-tag cleavage og renhet.
  9. Konsentrere karyopherin î± 8 mg/mL og flash-fryse i flytende nitrogen (trinn 3.15-3.17).

5. in Vitro Kinase analysen med Cdk1/Cyclin B

  1. In vitro kinase analysen
    Merk: Ved ankomst av kinase, gjøre små dele, flash-fryse dem i flytende nitrogen og lagre dem på-80 ° C. Bruk innen 6 måneder. Mens Molekylvekten er 34 kDa for Cdk1 og 48 kDa for cyclin B, er den tilsynelatende Molekylvekten cyclin b på SDS-side 60 kDa.
    1. Forberede 10 x PK buffer (følger med på kinase) bruker 0,5 M Tris-HCl, 0.1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0,1% Brij 35, pH 7.5 på 25 ° C.
    2. Forberede 10 x ATP lager: lage en løsning 4 mm ATP i 1 x PK buffer, og sjekk siste pH i aksjen. Lagre i små dele på 20 ° C og unngå fryse-Tin sykluser.
    3. Mix 40 µL av CENP-F fragmentere (i en konsentrasjon av 3.3 mg/mL, eller 400 µM), 6 µL 10 x PK buffer, 3 µL ultrapure vann, 6 µL ATP 10 x lager og 5 µL menneskelige Cdk1/cyclin B (1 µg, 100 U) i en 0,5 mL microtube.
      Merk: CENP-F fragmentet har en molar masse 8.6 kDa og fire Cdk1-spesifikke fosforylering områder. En ny underlaget, justere kinase konsentrasjonen i analysen ifølge molar konsentrasjonen av protein og av antall fosforylering nettsteder. Aktiviteten av menneskelig rekombinant Cdk1/cyclin B aksjen er 20.000 U/mL, og til aktiviteten er 1.000.000 U / mg. 1 U er definert som Cdk1/cyclin B må katalysere overføring av 1 pmol av fosfat til Cdk1 peptid substrat PKTPKKAKKL-NH2 (50 µM) i 1 min på 30 ° C (se Tabell for materiale).
    4. Forberede en kontroll reaksjon uten Cdk1/cyclin B. Incubate reaksjoner i et vannbad 1-16 h på 30 ° C.
  2. Analysere 2,5 µL av kinase analysen reaksjon og 2,5 µL av kontrollen av SDS-side (trinn 3.11), bruke en gel med 16% akrylamid. For å øke oppløsningen, Utvid kjøretiden.
  3. Legge til en lik mengde 6 M guanidine hydroklorid løsning gjenværende kinase analysen reaksjonen (og kontrollen). Siste guanidine hydroklorid konsentrasjonen blir 3 M. analysere disse prøvene av massespektrometri (del 6) å identifisere fosforylering nettsteder eller sende prøvene til et massespektrometri for analyse, og deretter utføre funksjonen bekreftelse ( Del 7).
    Merk: For påfølgende massespektrometri analysen er det svært viktig at fosforylering effektiviteten av de individuelle områdene er så høyt som mulig, helst 100%, ellers fosforylering nettsteder kan ikke tilordnes. For å øke fosforylering effektivitet, legge større mengder Cdk1/cyclin B og øke inkubasjon til 16 timer. Konsentrasjonen av ATP kan også bli fordoblet.
  4. For feilsøking, kan du utføre en i vitro kinase analyse av CENP-F (rester 2,987-3,065) som en positiv. Bruke friske grupper av Cdk1/cyclin B med høy aktiviteter.

6. identifikasjon av Cdk1-spesifikke fosforylering områder av massespektrometri

  1. Denature og desalt protein prøvene, utføre microbore omvendt fase flytende kromatografi PLRP300 kolonnen.
  2. For å få antall fosforylering områder i CENP-F fragmentet, analysere den intakt i vitro fosforylert CENP-F 84-mer ved electrospray ionization ion felle massespektrometri (ESI-ITMS)44,45.
  3. For å vurdere phosphoamino acid områdeplasseringen CENP-f, fosforylert forberede trypsin fordøyer av i vitro CENP-F protein prøver. Desalt til trypsin fordøyer med avsalte Pipetter tips.
  4. Analysere tryptic oppsummeringer av CENP-F av electrospray ionization Fourier transformere ion cyclotron resonans massespektrometri (ESI-FTICR MS). Utføre analyse på en ESI-FTICR masse spectrometer med en akkumulering tid på 169 µs.
    Merk: Nøyaktigheten av massene bestemmes av ESI-FTICR MS ligger 0.005 amu. For å måle forholdet mellom hver phosphorylated Art respektive totale protein beløpet, Bestem peak høydene av til masse spectra.

7. funksjonell verifikasjon: Testing av Phosphomimetic mutasjoner på Protein-protein interaksjoner av analytiske størrelse utelukkelse kromatografi

Merk: For funksjonell bekreftelse av identifisert Cdk1-spesifikke fosforylering områder, phosphomimetic mutanter av CENP-F fragmenter ble opprettet ved å erstatte de identifiserte fosforylering nettstedene med aspartates. Negativ ladning av aspartate etterligner effekten av fosforylering. En S3048D mutant av CENP-F fragment (rester 2,987-3,065) ble opprettet.

  1. For funksjonelle bekreftelse, sammenlign binding av vill-type og phosphomimetic CENP-F fragmenter karyopherin î±. bruke en analytisk gel filtrering som bindende analysen. Analytiske gel filtrering, rense CENP-F fragmenter av glutation affinitet kromatografi (trinn 3.1-3.12), og hoppe over gel filtrering trinn.
  2. Konsentrere protein til 5-6 mg/mL. Flash-fryse protein dele i flytende nitrogen (trinn 3.15-3.17).
  3. Mix renset CENP-F fragmenter (0,1 mg, vill-type eller S3048D variant) og renset karyopherin î± (0,7 mg) i 1:1 molar forholdet. Juster volumet eksempel 200 µL med gel filtrering buffer. Inkuber utvalget for 30 min på is, filtrere utvalg (0,2 µm porestørrelse) og fjerne prøven ved sentrifugering (25 min, 21,700 x g, 4 ° C)
  4. Skille den utvalg av størrelse utelukkelse kromatografi (trinn 3,13-3.14). Bruke en gel filtrering buffer bestående av 20 mM HEPES, pH 7.5, 150 mM NaCl, og 2 mM DTT. Utfør analytisk gel filtrering forsøkene under like for alle utvalg.
  5. Kalibrere kolonnen analytisk gel filtrering molekylvekt standarder av kjente Molmasse som beskrevet av produsenten.
  6. Analysere elueringsrør fraksjoner av 16% SDS-side (trinn 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Vi har nylig brukt i vitro kinase analysen (figur 1) til å identifisere Cdk1-spesifikke fosforylering områder i et CENP-F-fragment som inneholdt en cNLS10. Dette signalet gir kjernefysiske lokalisering av CENP-F under mesteparten av interphase. I G2 fase eksporteres CENP-F fra kjernen til stoffer i en Cdk1-avhengige måte. For å få mekanistisk innsikt i hvordan Cdk1 regulerer mobilnettet lokalisering av CENP-F, analysert vi en rekke CENP-F for å forutsi Cdk1-spesifikke fosforylering områder, bruker IGPer server36,37. I cNLS av CENP-F, tre Cdk1-spesifikke fosforylering områder var spådd på rester 3,042, 3045, og 3,048 (tabell 1). En annen Cdk1-spesifikke fosforylering området ble også spådd for rester 3,007 (tabell 1)10. Derfor hypotese vi at Cdk1 regulerer CENP-F lokalisering direkte ved fosforylering i sin cNLS.

Å teste om cNLS CENP-f er et medium for Cdk1, vi utført kinase i vitro analysen med renset menneskelige CENP-F fragmentet (rester 2,987-3,065) og menneskelige Cdk1/cyclin B. In vitro fosforylert CENP-F ble analysert på 16% SDS-side, sammen med en negativ kontroll som manglet kinase Cdk1 (figur 2A)10. For i vitro fosforylert CENP-F, er en klar oppadgående Skift observert i bandet på gel sammenlignet med kontrollen negative. Dette er typisk for fosforylert proteiner som hver fosfatgruppe legger to negative kostnader og ekstra masse. Disse resultatene tyder på at CENP-F er fosforylert av Cdk1/cyclin B10.

Bestemme antall CENP-F fosforylering områder og kvantifisere fosforylering effektiviteten av disse nettstedene, ble intakt i vitro fosforylert CENP-F fragmentet (84-mer) analysert av massespektrometri (ESI-ITMS)10. De observerte ESI-ion felle masse spektret (figur 2B) antyder at intakt CENP-F fragmentet er fosforylert på fire steder (tabell 1)10.

Plasseringen til webområdene fosforylert aminosyre i rekkefølgen av CENP-F ble vurdert ved å undersøke tryptic format av ESI-FTICR MS. Trypsin kløyver proteinet kjeder etter lysines og arginines, og et trypsin Sammendrag av CENP-F fragment resulterte i flere peptider, inkludert en som inneholdt rester 3,031-3, 052. Masse spektra av denne CENP-F peptid var forenlig med fosforylering på rester T3042, T3045 og S3048, som er plassert innenfor cNLS (tabell 1)10. Masse spektra av en annen tryptic peptid (rester 2,995-3,016) var i samsvar med fosforylering på S3007 (tabell 1)10. Alle fire Cdk1-spesifikke fosforylering områder ble også spådd fra sekvensen. Cdk1-spesifikk underlag inneholder ofte en proline ved rester som er fosforylert6, som observert i rester T3042, T3045 og S3007. Det bør bemerkes at S3048 er et litt uvanlige Cdk1-spesifikke fosforylering område, som en fenylalanin ligger serine. For å konkludere, tyder resultatene på at CENP-F er spesielt fosforylert på rester 3,007, 3,042, 3,045 og 3,048 av kinase Cdk1. Tre av disse rester ligger i cNLS av CENP-F (tabell 1), som angir at Cdk1 kan regulere CENP-F mobilnettet lokalisering gjennom fosforylering av cNLS i G2 fase, når Cdk1 blir aktive10.

For å kontrollere at disse Cdk1-spesifikke fosforylering områder har en fysiologisk funksjon, skapte vi den phosphomimetic variant S3048D10. Phosphomimetic mutasjoner etterligne effekten av fosforylering ved negativt ladet rester. Neste, vi renset den phosphomimetic versjonen av CENP-F fragment som inneholder cNLS. CNLS av CENP-F er anerkjent av kjernefysiske transport reseptoren karyopherin α, som binder seg til høy affinitet og kreves for kjernefysisk import av CENP-F. For å teste om phosphomimetic mutasjon svekker samspillet mellom cNLS av CENP-F med sine kjernefysiske transport reseptoren karyopherin α, utført vi en bindende analysen (Figur 3)10. I disse eksperimentene, en renset CENP-F fragment (vill-type eller S3048D variant) ble blandet med renset menneskelige karyopherin α og blandingen ble skilt av analytiske størrelse utelukkelse kromatografi. I tillegg ble proteiner også analysert individuelt. SDS side analyse av elueringsrør fraksjoner avdekket at vill-type CENP-F fragmentet med cNLS samhandler sterkt med karyopherin α, siden begge proteiner co elute (Figur 3)10. Men bare en ubetydelig mengde CENP-F S3048D fragmentet binder til karyopherin α, og disse proteinene elute separat (Figur 3)10. Disse resultatene tyder på at fosforylering av rester 3,048 av cNLS av CENP-F ville ha en sterk effekt på samspill med kjernefysiske transport faktor karyopherin α. Det bør bemerkes at kjernefysisk import priser er svært avhengig av slektskap av et kjernefysisk lokalisering signal mot et kjernefysisk transport faktor46, og derfor er det forventet at disse mutasjonene tregere kjernefysiske import10.

Figure 1
Figur 1: skjematisk fremstilling av Cdk1 i vitro kinase analysen. Klikk her for å se en større versjon av dette tallet.

Figure 2
Figur 2: CENP-F er fosforylert av Cdk1/cyclin B. (A) å identifisere Cdk1 bestemt fosforylering nettsteder, i vitro kinase analysen ble utført med renset CENP-F (rester 2,987-3,065). SDS side analyse av en negativ kontroll uten Cdk1/cyclin B vises i venstre kjørefelt (-Cdk1), siden i vitro fosforylert CENP-F i riktig kjørefelt (+ Cdk1). Molekylvekt standarder er angitt. Merk oppadgående skifte av fosforylert CENP-F på SDS-side, hvilke er gjennomført med vellykket fosforylering. Cdk1 og cyclin B vises som svake båndene 34 kDa og 60 kDa. (B) ESI-ion felle massespektrometri intakt fosforylert CENP-f fra (A) ble brukt til å bestemme fosfat belastningen av intakt phosphorylated CENP-F (84-mer). Tilsvarende mass spekteret er vist. Intensiteten tegnes versus masse-til-lade forholdet (m/z). Spekteret viser 10 til +14 kostnad stater av intakt CENP-F fragment etter fosforylering. De angir arter innbyggere med 0, 1, 2, 3 og 4 fosfat estere. For å måle forholdet mellom hver art totale protein beløp, topp høydene var bestemt og forhold (tabell 1). Dette tallet er endret fra10 og ble gjengitt med tillatelse av Taylor og Francis utgiver. Klikk her for å se en større versjon av dette tallet.

Figure 3
Figur 3: funksjonell bekreftelse: phosphomimetic mutasjoner av CENP-F sterkt redusere samspillet med kjernefysiske transport reseptoren karyopherin î±. (En-F) Renset CENP-F fragmenter (rester 2,987-3,065) (0,1 mg) og renset karyopherin î± (0,7 mg) og ble blandet i 1:1 molar ratio og analyseres av størrelse utelukkelse kromatografi. CENP-F fragmenter og karyopherin î± ble også analysert individuelt. SDS side analyse av topp fraksjoner vises. Elueringsrør volumer er angitt nederst (i 0,6 mL trinn). Til venstre angis plasseringen av molekylvekt markør band og deres massene i kDa. En stjerne markerer spor av gjenværende GST (glutation S-transferase). (A) Karyopherin î±. (B) elueringsrør profiler. Absorbansen på 280 nm tegnes versus elueringsrør volumet. Elueringsrør profilen for karyopherin î± (rød) er kledde med elueringsrør profiler blandinger av karyopherin î± med CENP-F fragmenter (vill-type: grønn; phosphomimetic S3048D mutant: blå). Merk at tillegg av vill-type CENP-F fragment skifter elueringsrør volumet av karyopherin î± toppen til høyere messe, som er i samsvar med binding av CENP-F vill-type fragment. Dette skiftet er ikke observert når CENP-F fragmentet med phosphomimetic mutasjon S3048D legges, antyder at phosphomimetic mutasjon sterkt reduserer samspillet av CENP-F med karyopherin î±. (C) CENP-F vill-type fragment (wt) og karyopherin î±. (D) CENP-F wt fragment. (E) CENP-F S3048D fragment og karyopherin î±. (F) CENP-F S3048D fragment. Dette tallet ble opprettet med data fra10. Klikk her for å se en større versjon av dette tallet.

Tabellen 1A. Sekvens av CENP-F fragment (rester 2987-3065) med spådd Cdk1-spesifikke fosforylering områder fremhevet av større skriftstørrelse. Tryptic fragmenter er merket med fet skrift og understreket.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabellen 1B. Massespektrometri analyse av intakt CENP-F
84 mer etter i vitro fosforylering med Cdk1/cyclin B
# fosforylering nettsteder (P) oppdaget Fosfat Last uttrykt som en prosentandel av total protein
CENP-F 2987-3065 0P 6%
1 P 37%
2P 40%
3P 15%
4P 3%
Tabellen 1C. Massespektrometri analyse av tryptic peptider CENP-f etter i vitro fosforylering med Cdk1/cyclin B
# fosforylering nettsteder Fosfat belastning
Tryptic phosphopeptide, 0P 57%
rester 2995-3016 1 P 43%
Tryptic phosphopeptide, 0P 7%
rester 3031-3052 1 P 64%
2P 29%
3P 1%

Tabell 1: Masse massespektrometri analyse av CENP-F fragment etter i vitro fosforylering med Cdk1/cyclin B. Denne tabellen ble opprettet med data fra10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Våre i vitro kinase analysen er en meget kraftfull metode å identifisere molekylære mål for kinase Cdk1, som er en master kontroller av cellen syklus og regulerer mange viktige cellulære prosesser. Metoden bestemmer hvis en renset protein er et medium for Cdk1 og lar identifikasjon av bestemte fosforylering nettsteder. Dette forenkler mekanistisk studier for regulering av cellulære prosesser ved fosforylering gjennom Cdk1.

Den mest kritiske faktoren for vellykket identifikasjon av webområdene fosforylering av massespektrometri er fosforylering effektiviteten av kinase analysen. Fosforylering effektiviteten av de individuelle områdene bør være så høyt som mulig, helst 100%. Dette kan oppnås ved å øke mengden av Cdk1/cyclin B og øke inkubasjon tiden til 16 timer. Når beløpet av Cdk1/cyclin B nødvendig molar konsentrasjonen av protein og antall fosforylering nettsteder bør vurderes. Dette er spesielt viktig hvis flere fosforylering områder finnes i målet protein. Det bør også bemerkes at aktiviteten til kommersielle Cdk1/cyclin B kan variere fra parti til parti, og at kinase kan miste aktivitet raskt. Hvis i vitro fosforylering mislykkes, anbefales det å teste aktiviteten til kinase. Som en positiv for feilsøking benyttes i vitro fosforylering CENP-f (rester 2,987-3,065). Som en negativ kontroll, skal en reaksjon uten Cdk1/cyclin B tillegg utføres og analysert. En annen nyttig negativ kontroll er bruken av en kinase døde mutant av Cdk1, som er katalytisk inaktiv, fordi en enkelt punkt mutasjon (D146N)47,48,49. I tillegg for å bekrefte identifiserte fosforylering nettsteder, kan en phosphonegative versjon av målet protein opprettes, hvor fosforylering nettsteder er erstattet med alanines. Hvis webområdene identifiserte fosforylering riktige, ikke tilsvarende phosphonegative mutant fosforylert i vitro.

Et enkelt verktøy for å oppdage vellykket fosforylering av målet protein er enkel SDS side gel Skift analysen beskrevet her. Fosforylert proteiner vanligvis overføre tregere på SDS-side enn sine unphosphorylated kolleger, den ekstra og negative kostnader. Merk at for store proteiner, optimalisering av SDS side analysen er nødvendig for å forbedre oppløsningen tilstrekkelig å visualisere gel skiftet. Et nyttig verktøy for bestemte separasjon av fosforylert proteiner er fosfat-bindende tag (Phos-tag) SDS-side. Fosforylert proteiner i en gel med Phos-tag akrylamid er visualisert som tregere migrere band sammenlignet med tilsvarende dephosphorylated proteiner50,51.

For å oppnå høy kvalitet masse spectra, er det svært viktig at protein for i vitro kinase analysen er ren og homogen. Våre rensing protokollen oppnår dette ved å kombinere flere svært selektive kromatografi trinn og hindre protein fornedrelse og oksidasjon gjennom tillegg av proteasehemmere og reductants. Rensing protokollen kan endres for å elute protein av glutation (dvs.med GST-koden intakt); men bør det vurderes at GST-koden legger en annen 25 kDa, og store proteiner er utfordrende mål for massespektrometri. Alternativt, våre rensing protokoll for hans6-tag fusion proteiner kan også brukes.

Denne protokollen kan også endres for å identifisere fosforylering områder som er spesifikke for andre kinaser. Det eneste kravet er at den renset kinase er tilgjengelig, aktiv og tilstrekkelig stabilt. Analysen betingelser må justeres for hver kinase å oppnå maksimal aktivitet. Parametere å optimalisere inkluderer mengden av kinase, reaksjon buffer (pH, saltkonsentrasjon), inkubasjonstiden, reaksjon temperatur og ATP konsentrasjon. In vitro kinase analyser har blitt brukt til å identifisere fosforylering nettsteder for mange kinaser inkludert Plks (polo-lignende kinaser)52,53,54, og MAPK/ERK kinaser (mitogen-aktivert protein kinaser / ekstracellulære signal-regulert kinaser)55,56.

Mens styrken i denne metoden er å identifisere bestemte fosforylering områder i et renset protein, bør det bemerkes at et fosforylering område som et mål for Cdk1 i vitro ikke nødvendigvis være fosforylert i vivo. I vivo, ytterligere regulatoriske mekanismer er på plass, som kan gi et fosforylering sted utilgjengelig for anerkjennelse av Cdk1. For eksempel kan ekstra samspill partnere være tilstede i vivo, som kan skjule en fosforylering området eller gjøre den tilgjengelig gjennom strukturelle endringer. Underlaget må videre colocalize med Cdk1/cyclin B i kjernen i G2 fase for å bli fosforylert. I tillegg kan post-translasjonell endringer eller andre juridiske prosesser påvirke konformasjon av målet protein i vivo, som kan gjøre et fosforylering område utilgjengelige. Disse begrensningene kan overvinnes ved å utforme riktig eksperimenter i celler eller dyremodeller som bekrefter at de identifiserte fosforylering nettstedene har en fysiologisk funksjon. Her bruker vi en enkel binding analysen for funksjonell bekreftelse, siden fosforylering reduserer samspillet av CENP-F med karyopherin î±. funksjonell verifikasjon bør også utføres i sammenheng med celler eller en dyremodell. Derfor vi også transfekterte fluorescerende fusion proteiner av CENP-F-fragmenter som inneholdt cNLS i HeLa celler10. Phosphomimetic mutasjoner i cNLS av CENP-F redusert kjernefysiske lokalisering, som bekreftet en fysiologisk funksjon av disse fosforylering nettsteder10.

Flere verktøy er tilgjengelig for funksjonell bekreftelse av fosforylering i celler eller dyremodeller. Phosphomimetic mutasjoner, som etterligner effekten av fosforylering av negative kostnader, er mye brukt til dette formålet. For disse er fosforylering området (serine eller threonin) erstattet av aspartate eller glutamat. Fordelen er at bare et punkt mutasjon av målet protein er nødvendig. Det bemerkes at mens phosphomimetic mutasjoner ble brukt i mange tilfeller for funksjonell bekreftelse, de fungerer spesielt i tilfeller hvor ansvaret endringer er den dominerende bidragsyteren for regulering i stedet for en strukturell endring. Phosphomimetic mutasjoner mislykkes å etterligne effekten av fosforylering i mange andre tilfeller (f.eks, 11). Men andre tilnærminger er tilgjengelig for funksjonell bekreftelse fosforylering nettsteder, inkludert bruk av phosphonegative mutasjoner: disse mutasjonene hindre fosforylering ved å erstatte fosforylering nettsteder med alanin. En annen nyttig tilnærming for funksjonell bekreftelse i mobilnettet sammenheng er uttrykk for en kinase døde mutant av Cdk1, som er inaktivert av en lett-å-introdusere punkt mutasjon (D146N)47,48,49. Spesielt, er flere små molekyl Cdk1 hemmere kommersielt tilgjengelig som Flavopiridol og RO-3306, som kan brukes for funksjonell studier i celler eller dyremodeller7,8,11. Disse hemmere er godt karakterisert, og flere er i kliniske studier for kreftbehandling (for en gjennomgang se9).

Mens mange protein fosforylering nettsteder har blitt identifisert i proteomic studier, kinase spesifisitet er ukjent, og i vitro kinase analysen er en av få metoder tilgjengelig for å identifisere underlag av Cdk1. Andre tilnærminger har også blitt brukt. Cdk1 mål ble identifisert ved hjelp av et utviklet Cdk1 enzym. Den har en større substrat binding lomme og godtar flere store versjoner av ATP som en substrat6. Dette store underlaget kan ikke binde til vill-type kinaser. Tillegg av radiolabeled store ATP til en celle pakke som inneholder endrede Cdk1 enzymet derfor fører til bestemte merkingen av direkte substrater Cdk1. 200 Cdk1 mål ble identifisert i spirende gjær med denne metoden. men det kan ikke brukes på pattedyrceller, som er en avgjørende begrensning. I en annen studie, ble Cdk1 underlag identifisert i menneskelig vev kultur celler ved å utføre kvantitativ phosphoproteomics analyse ved hjelp av to små molekyl hemmere av Cdk1, Flavopiridol og RO-3306. 1215 phosphopeptides på 551 proteiner ble betydelig redusert på Cdk1 hemmer tillegg7. Denne metoden kan skjermen en hel proteom for potensielle Cdk1 mål, men fører mål må bekreftes, f.eksav en i vitro kinase analysen.

I fremtiden, vil i vitro kinase analysen trolig bli kombinert med høy gjennomstrømning skjermer for Cdk1 underlag som er under utvikling. Mange menneskelige Cdk1 underlag gjenstår å bli identifisert på grunn av det store antallet Cdk1 underlag i proteom, og i vitro kinase analysen vil være et viktig verktøy for å identifisere, kart og kontrollere disse nettstedene.

I vitro kinase analysen er et kraftig verktøy for å identifisere mål for kinase Cdk1 og identifisere bestemte fosforylering områder. Identifikasjon av disse fosforylering kan mekanistisk studier for regulering av cellulære prosesser av Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Forfatterne ikke avsløre.

Acknowledgments

Vi takker Dr. David King, Howard Hughes Medical Institute, University of California i Berkeley for massespektrometri analyse og nyttige kommentarer. Vi takker Dr. Xuelian Zhu, Shanghai, institutter for biologiske basalfag, kinesiske vitenskapsakademi, Shanghai, Kina for å gi en full lengde CENP-F-konstruksjon. Til slutt, vi takker Dr. Susan Bane, Dr. Brian Callahan og Dr. Christof Grewer ved Binghamton University for tilgang til utstyr. Denne forskningen ble finansiert av Research Foundation for State University of New York og ved Institutt for kjemi, State University of New York på Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identifikasjon av Cyclin-avhengige Kinase 1 bestemt fosforylering områder av en <em>In Vitro</em> Kinase analysen
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter