Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identificazione della chinasi Cyclin-dipendente 1 siti di fosforilazione specifico da una chinasi In Vitro test

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Chinasi cyclin-dipendente 1 (Cdk1) sono attivato nella fase G2 del ciclo cellulare e regola molte vie cellulari. Qui, presentiamo un protocollo per un'analisi in vitro della chinasi con Cdk1, che permette l'identificazione dei siti di fosforilazione Cdk1 specifici per stabilire obiettivi cellulari di questa chinasi importante.

Abstract

Chinasi cyclin-dipendente 1 (Cdk1) sono un master controller per il ciclo cellulare in tutti gli eucarioti e fosforilano un stimato 8-13% del proteoma; Tuttavia, il numero degli obiettivi identificati per Cdk1, particolarmente in cellule umane è ancora basso. L'identificazione dei siti di fosforilazione Cdk1-specifici è importante, in quanto forniscono meccanicistici intuizioni come Cdk1 controlla il ciclo cellulare. Regolazione del ciclo cellulare è fondamentale per la segregazione del cromosoma fedele, e difetti in questo processo complicato portano ad aberrazioni cromosomiche e cancro.

Qui, descriviamo una in vitro analisi della chinasi che è utilizzata per identificare siti di fosforilazione Cdk1 specifici. In questo saggio, una proteina purificata è fosforilata in vitro di commercialmente disponibile umano Cdk1/ciclina B. Successful fosforilazione è confermata da SDS-PAGE, e siti di fosforilazione sono successivamente identificate mediante spettrometria di massa. Descriviamo anche protocolli di purificazione che producono preparati proteici altamente puro e omogeneo adatti per l'analisi della chinasi e un'analisi obbligatoria per la verifica funzionale dei siti di fosforilazione identificati, che l'interazione tra le sonde un segnale di localizzazione nucleare classica (cNLS) e relativo trasporto nucleare del ricevitore karyopherin α. Per aiutare con disegno sperimentale, passiamo in rassegna gli approcci per la stima dei siti di fosforilazione Cdk1 specifici da sequenze proteiche. Insieme questi protocolli presentano un approccio molto potente che produce siti di fosforilazione Cdk1 specifici e consente studi meccanicistici in modo Cdk1 controlla il ciclo cellulare. Poiché questo metodo si basa su proteine purificate, può essere applicato a qualsiasi modello organismo e rendimenti risultati affidabili, specialmente se combinata con studi funzionali delle cellule.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Le chinasi sono enzimi che regolano molti processi cellulari e trasferiscono gruppi fosfato da ATP su substrati. Questa fosforilazione è reversibile, veloce, aggiunge due cariche negative e memorizza l'energia libera ed è uno delle modificazioni post-traduzionali più comune usate dalle cellule. CDK1, che è anche conosciuto come omologo di proteina 2 ciclo di divisione cellulare (cdc2) è un master controller per il ciclo cellulare in tutti gli eucarioti1,2,3,4,5e fosforila un orario 8-13% del proteoma6,7.

Mentre gli studi di proteomica recenti hanno identificato molti siti di fosforilazione di proteine, nella maggior parte dei casi, la chinasi responsabile di queste modificazioni è sconosciuta. Il numero di bersagli Cdk1 noti, in particolare nelle cellule umane è basso7. L'identificazione dei siti di fosforilazione Cdk1-specifici è importante, in quanto consente studi meccanicistici che stabiliscono come Cdk1 controlla il ciclo cellulare. Regolazione del ciclo cellulare è importante per la segregazione del cromosoma fedele e la divisione cellulare, e una miriade di processi cellulari devono verificarsi per supportare questa importante funzione fisiologica. Questo include arrestare trascrizione e traduzione prima dell'inizio della mitosi, come pure una riorganizzazione drammatica nella struttura cellulare e organizzazione, ad esempio lo smontaggio dell'involucro nucleare, condensazione cromosomica, Assemblea del fuso mitotico e. Deregolamentazione e gli errori in questi processi causano cancro, difetti di nascita o morte cellulare mitotica. Inibitori specifici di Cdk1 come RO-3306 sono stati sviluppati8, che forniscono potenti strumenti per studi funzionali, e alcuni di questi inibitori sono attualmente nei test clinici per il trattamento del cancro (Vedi9 per la revisione).

Qui, descriviamo una in vitro analisi della chinasi che permette l'identificazione dei siti di fosforilazione Cdk1-specifici. In questo test, disponibili in commercio umano Cdk1/ciclina B è utilizzato per fosforilare un obiettivo purificato della proteina in vitro. Fosforilazione di un substrato aumenta la sua massa e aggiunge due cariche negative; di conseguenza, fosforilazione successo è confermata da uno spostamento verso l'alto della band gel di proteina su SDS-PAGE. Siti di fosforilazione CDK1 specifici sono successivamente identificati dall'analisi di spettrometria di massa della proteina in vitro fosforilato. Per aiutare con disegno sperimentale, esaminiamo anche strumenti computazionali e riferimenti per la previsione dei siti di fosforilazione Cdk1 specifici dalla sequenza della proteina. Inoltre, descriviamo anche protocolli di purificazione che producono preparati proteici altamente puro e omogeneo adatti per l'analisi della chinasi. Infine, i siti di fosforilazione identificata devono essere verificati da studi funzionali e un'analisi di associazione semplice è descritto qui per tale scopo. Combinato, questo è un approccio molto potente che produce siti di fosforilazione Cdk1 specifici e consente studi meccanicistici in modo Cdk1 controlla il ciclo cellulare7,10,11. Poiché questo metodo si basa su proteine purificate, può essere applicato a qualsiasi risultati affidabili di modello, organismo e rendimenti. Tuttavia, è consigliabile verifica funzionale dei siti fosforilazione ottenuti in vitro , come le cellule hanno ulteriori meccanismi di regolamentazione in vigore, come modifiche di posttranslational, partner di interazione o localizzazione cellulare che può rendere siti di fosforilazione accessibile o inaccessibile per il riconoscimento di Cdk1.

CDK1 riconosce un sito di fosforilazione di consenso che si compone di (Ser/Thr-Pro-X-Lys/Arg), dove X è ogni residuo e una serina o treonina è il sito di fosforilazione. Particolarmente importante per il riconoscimento è la presenza della prolina in posizione + 1. Inoltre, i residui di base sono preferiti nelle posizioni + 2 o + 3, con la maggior parte dei siti di fosforilazione Cdk1 specifici contenenti un Lys o Arg presso il + 3 posizione6,12.

Attivazione di Cdk1 è strettamente regolato e conduce all'inizio della mitosi1,2,3,4,5. L'attività di chinasi ciclina-dipendenti in generale dipende dalla loro associazione con distinte cicline (ciclina A, B, C, D ed E in esseri umani), che si sono espressi a livelli durante il ciclo cellulare13di oscillazione. L'espressione CDK1 è costante attraverso il ciclo cellulare e la regolazione della sua attività si basa sulla sua associazione con la subunità regolatorie cicline A e ciclina B5,13,14,15, come Beh come modificazioni post-traduzionali. Formazione del complesso Cdk1/ciclina B è necessaria per le chinasi attivazione5,14,15,16,17,18. Nella fase G2, ciclina B è tradotto nel citosol e importato nel nucleo dove si lega a Cdk15,14,15,16,17,18; Tuttavia, Cdk1/ciclina B è detenuto inattivato da fosforilazione in residui Thr14 e Tyr15 dalla chinasi Cdk1-inibitorio umani Myt1 (chinasi cdc2-inibitorio di membrana-collegato della tirosina e treonina-specifiche) e Wee1, rispettivamente19, 20,21. La fine della fase G2, defosforilazione di Thr14 e Tyr15 dalla divisione cellulare ciclo 25 fosfatasi (cdc25) attiva l'attività della chinasi del complesso Cdk1/cyclin B e innesca l'inizio della mitosi12,14, 18 , 20 , 22 , 23. fosforilazione di Thr161 è anche necessaria per l'attivazione di chinasi ciclina Cdk1/B ed è mediato da Cdk7, l'attivazione di Cdk chinasi (CAK)18. Degradazione del cyclin B in anafase inattiva Cdk1, permettendo l'uscita dalla mitosi24,25. L'attivazione della chinasi Cdk1/ciclina B è pertanto un processo complicato. Il protocollo presentato qui viene eseguito con commercialmente disponibili Cdk1/ciclina B. Durante espressione ricombinante di questo complesso in cellule di insetto, essa è attivata in vivo di chinasi endogene14,20 e resta attiva nello stato purificato. La risultante attiva, ricombinante umano Cdk1/ciclina B è adatto per le analisi in vitro della chinasi.

Qui, descriviamo un protocollo per l'identificazione dei siti di fosforilazione Cdk1 specifici nel centromero umano proteina F (CENP-F)10. CENP-F è una proteina di cinetocore che risiede nel nucleo durante la maggior parte di interfase (G1 e fase S) e viene esportata nel citosol in G2 fase26,27,28 in un dipendente Cdk1 modo10, 11. localizzazione nucleare è conferita da un bipartito cNLS26. cNLSs sono riconosciuti dal trasporto nucleare di fattore α karyopherin, che facilita, insieme a β di karyopherin e RanGDP, l'importazione del cNLS-carico nel nucleo29. Export nucleare nella fase G2 è facilitata tramite un percorso di esportazione sconosciuto10. Una volta CENP-F risiede nel citosol, esso viene reclutato alla busta nucleare e reclute a sua volta il motore della proteina dineina complesso30,31. Questo percorso è importante posizionare il nucleo rispettivo per il centrosoma durante le fasi iniziali di assemblaggio del fuso mitotico in modo dineina-dipendente, che è importante per la corretta fasatura della voce mitotica e per un processo fondamentale nel cervello sviluppo30,31,32. A partire dalla fase G2, CENP-F è anche assemblati nel cinetocore dove ha ruoli importanti per fedele cromosoma segregazione27,28,33,34,35 . Un passo fondamentale di regolamentazione di queste vie è l'esportazione nucleare di CENP-F nella fase G2, che è dipenda Cdk110,11. Descriviamo qui un protocollo per l'identificazione dei siti di fosforilazione Cdk1 specifici in cNLS CENP-f. Le mutazioni di Phosphomimetic di questi siti rallentano importazione nucleare di CENP-F, suggerendo che Cdk1/ciclina B regola direttamente la localizzazione cellulare di CENP-F da fosforilazione di sua cNLS10.

Nel complesso, questa analisi in vitro della chinasi permette l'identificazione di substrati specifici per proteine chinasi Cdk1. depurata bersaglio sono fosforilati in vitro di commercialmente disponibile Cdk1/ciclina B complesso e i siti di fosforilazione Successivamente vengono identificati mediante spettrometria di massa. L'identificazione dei siti di fosforilazione Cdk1 specifici supporta studi meccanicistici che rivelano come Cdk1 controlla il ciclo cellulare.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. previsione di siti di fosforilazione Cdk1 specifici dalla sequenza della proteina

  1. Prima di iniziare l'analisi della chinasi, analizzare la sequenza della proteina per siti di fosforilazione Cdk1 specifici previsti e cercare la letteratura per i siti di fosforilazione sperimentalmente stabilito con specificità chinasi sconosciuto. Utilizzare i seguenti strumenti, banche dati e riferimenti che sono ricapitolati.
    1. Utilizzare il iGPS 3.0 software36,37 (http://gps.biocuckoo.org/online_full.php) per prevedere i siti di fosforilazione Cdk1 specifici nella sequenza della proteina bersaglio. Utilizzare il link qui per una previsione completa che include annotazioni di struttura secondaria e accessibilità superficiale.
    2. Nel software, è necessario immettere la sequenza di proteine in formato FASTA. Specificità della chinasi, selezionare serina/treonina chinasi, CMGC, CDK, CDC2, CDK1e deselezionare tutte le altre specificità. Selezionare media come la soglia e clicca sul pulsante Invia .
    3. Confrontare i siti predetti risultanti con il sito di fosforilazione di consenso Cdk1 (Ser/Thr-Pro-X-Lys/Arg).
    4. È fondamentale verificare il sito previsto per la prolina accanto il residuo fosforilato (alcuni substrati Cdk1 vengono fosforilate a una minima del luogo (Ser/Thr-Pro)6,12). Inoltre, controllare i residui di base, che sono preferiti nelle posizioni + 2 o + 3, con la maggior parte dei siti di fosforilazione Cdk1 specifici contenenti un Lys o Arg alla posizione + 36,12.
  2. Verifica inoltre che il sito è accessibile per il riconoscimento, come la presenza di un sito completo consenso non è sufficiente per fosforilazione Cdk1.
    1. Ispezionare la superficie accessibilità e annotazione di predizione di struttura secondaria nell'output iGPS, che afferma che se il sito è previsto per essere accessibile; N - e C-termini delle proteine sono in molti casi flessibili e accessibili per la fosforilazione.
    2. Se una struttura ai raggi x della proteina bersaglio è disponibile, è possibile verificare l'accessibilità dei siti di fosforilazione putativo controllando la loro posizione nella struttura.
  3. Ricerca letteratura per siti di fosforilazione sperimentalmente stabilito con la specificità della chinasi sconosciuto utilizzando il database di UniProtKB/Swiss-Prot38 (http://www.uniprot.org).
    1. Immettere il nome della proteina nella casella di ricerca e fare clic sul pulsante Cerca . Selezionare la voce corretta sequenza. Siti di fosforilazione sono annotati e fa riferimento nella sezione modifiche dell'amminoacido .
    2. Ricerca per gli studi di proteomica di mitotici estratti di cellule umane linee7,39,40, che sono particolarmente utili perché Cdk1 diventa attivo nella fase G2 del ciclo cellulare.
  4. Identificare cNLS bipartito di NLSmapper (opzionale).
    Nota: Per le proteine che la spola tra il citoplasma e il nucleo, un meccanismo comune per regolamento di localizzazione cellulare è la fosforilazione di un cNLS bipartito in posizione-1 del motivo principale di Cdk1. La fosforilazione abolisce la localizzazione nucleare nel G2 fase10,41,42,43.
    1. Per tali proteine spola, identificare il cNLS nella sequenza della proteina di NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Incollare la sequenza della proteina come testo nella casella sequenza, selezionare un punteggio di cut-off di 5.0 e decide di cercare la NLS in tutta la regione. Fare clic sul pulsante di Predire NLS .
    2. Confrontare la risultante cNLS previsto contro la sequenza di consenso di un cNLS bipartito, che è costituito il motivo minore (Lys-Arg), un linker di almeno 10 residui e il motivo principale (Lys-Lys/Arg-X-Lys/Arg), dove X è qualsiasi residuo che non è caricata negativamente .
    3. Verifica se il sito di fosforilazione Cdk1 previsto (*) si trova adiacente al principale motivo in posizione-1 del linker: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Nota: La fosforilazione di un cNLS bipartito in posizione-1 da Cdk1 è stata stabilita come un meccanismo di regolazione per localizzazione cellulare per le diverse spola proteine10,41,42, 43.

2. espressione di proteine ricombinanti in Escherichia Coli

  1. Utilizzare i plasmidi di espressione da passaggi 2.1.1-2.1.2 per l'espressione di proteine ricombinanti in e. coli.
    1. Per creare l' espressione umana CENP-F (residui 2.987-3.065) costruire, generare inserti amplificando frammenti di DNA da reazione a catena della polimerasi (PCR) da un costrutto di CENP-F Full-Length (GenBank accession: U19769.1). Utilizzare i seguenti primer: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG e AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Nota: Il full-length plasmide CENP-F umano era generosamente fornito da Dr. X. Zhu, istituti per le scienze biologiche, Accademia cinese delle scienze, Shanghai, Cina.
      1. Clonare l'inserto nel vettore pGEX6p1 con i siti di restrizione BamHI e XhoI. Utilizzare questo plasmide per esprimere proteine di fusione di N-terminale del glutatione S-transferasi (GST) di CENP-F (residui 2.987-3.065).
        Nota: Il GST-tag possa essere spaccato fuori dalla proteasi PreScission (d'ora in poi denominato proteasi PS).
    2. Per l' umana espressione α karyopherin costruire, generare inserti amplificando frammenti di DNA mediante PCR da un modello di cDNA full-length karyopherin α2 (adesione sequenza NM_002264.3; primer: GCACTACATATGTCCACCAACGAGAATGCTAATA e TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Nota: A causa della somiglianza delle isoforme, questo costrutto di α2 karyopherin viene definito nel testo successivo come α karyopherin.
      1. Clonare l'inserto nel vettore con i siti di restrizione NdeI e XhoI pET28a-pres.
        Nota: Questo è un vettore di pET28a modificate in cui la sequenza che codifica per il sito di clivaggio della trombina è stata sostituita da una sequenza che codifica per un sito di clivaggio della proteasi di PS. Utilizzare questo plasmide per esprimere una proteina di fusione di karyopherin α con un N-terminale sua6-tag, dove il suo6-tag può essere clivata off di proteasi di PS.
  2. Per creare mutazioni puntiformi di una proteina dell'obiettivo, è necessario effettuare mutagenesi sito-diretta con un kit.
  3. Esprimere le proteine ricombinanti in e. coli per purificazione successiva.
    1. Rendere i seguenti stock: kanamicina 50 mg/mL (1:1, 000 soluzione di riserva), cloramfenicolo 35 mg/mL in 70% di etanolo (1:1, 000), ampicillina 100 mg/mL (1:1, 000) e 1 M isopropilico β-D-1-thiogalactopyranoside (IPTG; 1:5, 000).
    2. Filtrare le scorte di sterile e conservare a-20 ° C. Evitare cicli ripetuti di congelamento-scongelamento per IPTG.
    3. Trasformare 1 µ l di plasmide di espressione in 50 µ l di cellule competenti del ceppo di pLysS di e. coli Rosetta 2 (DE3), secondo le istruzioni del produttore.
    4. Piastra di coltura su agar di Luria-Bertani (LB) con cloramfenicolo (LB 35 µ g/mL) e ampicillina (100 µ g/mL LB) per il costrutto CENP-F, o cloramfenicolo e kanamicina (50 µ g/mL di coltura) per il costrutto α karyopherin. Incubare le piastre per 12-20 h a 37 ° C.
    5. Scegli una singola Colonia e inoculare 50 mL di LB completati con antibiotici (Vedi punto 2.3.4). Incubare la coltura agitando a 160-180 rpm per 12-20 h a 37 ° C.
    6. Preparare 1 L di LB medium in un mL di 2.800 sconcertato Fernbach boccetta. Fare due boccette per ogni coltura ed autoclave li. Per consentire l'aerazione, non riempire le boccette per più di due terzi il pallone volume. Matracci di Erlenmeyer possono essere usati pure.
    7. Aggiungere antibiotici (passo 2.3.4) e 10 mL di una soluzione di glucosio filtrato sterile 40% (p/v) per 1 L di raffreddato lb aggiungere 20 mL di coltura per 1 L di LB medium.
      Nota: L'assorbanza a 600 nm di un 01:10 diluizione della coltura deve essere compresa tra 0.15-0.2.
    8. Incubare le beute mentre si stringono a 160-180 giri/min a 37 ° C. Misurare l'assorbanza a 600 nm della cultura batteri regolarmente. Se l'assorbanza raggiunge 0.5-0.6, inducono l'espressione di proteine con l'aggiunta di 0,2 mM IPTG (200 µ l di stock di 1 M per 1 L di LB medium).
      Nota: È importante che le cellule sono indotte all'assorbanza corretta. Di solito ci vogliono 3-4 ore per raggiungere questo stadio.
    9. Incubare le beute agitando per 3 h a 37 ° C. Raccogliere le cellule mediante centrifugazione (15 min, 4.100 x g, 4 ° C, rotore). Scartare il surnatante. Risospendere il pellet cellulare in 20 mL di tampone di GST-associazione (CENP-F) o suo6-buffer obbligatorio (karyopherin α) per 1 L di cultura. Conservare le cellule a-80 ° C.
      1. Preparare il tampone di GST-associazione (Tris 10 mM pH 8.0 a 25 ° C, 150 mM NaCl, 1 mM dithiothreitol (DTT), 0,5 mM EDTA) e suo6-associazione tampone (10 mM Tris pH 8.0 a 25 ° C, 250 mM NaCl, 5 mM a pH imidazolo 8.0, 5mm β-mercaptoetanolo (BME)) in anticipo.

3. la purificazione della proteina ricombinante mediante cromatografia di affinità del glutatione e Gel filtrazione

  1. Rendere i seguenti stock: 1m DTT (1:1, 000 stock, sterile filtrata con pori di 0,2 µM e degassato); 250 mM phenylmethylsulfonyl fluoruro (PMSF; 1:1,000 magazzino in dimetilsulfossido). Conservare a-20 ° C. Evitare cicli ripetuti di congelamento-scongelamento.
  2. Rendere i buffer seguenti e raffreddare a 4 ° C.
    1. Preparare il buffer di GST-associazione utilizzando Tris 10 mM pH 8.0 a 25 ° C, 150 mM NaCl, 1 millimetro DTT, 0,5 mM EDTA.
    2. Preparare il tampone di eluizione GST utilizzando 10 mM ridotto il glutatione (0,15 g/50 mL) disciolto in un buffer di 50 mM Tris-HCl pH 8.0 a 25 ° C, 150 mM NaCl, 1 millimetro DTT. Verificare che il pH del tampone finale sia 8.0 e utilizzare lo stesso giorno che è stato fatto.
    3. Preparare il tampone di Gel-filtrazione utilizzando 20 millimetri Tris pH 7.5 a 25 ° C, 60 mM NaCl, 2 mM DTT. Sterile filtrare il buffer con un filtro di parte superiore della bottiglia (dimensione dei pori di 0,2 µM). Degassare il buffer mentre si mescolano sotto vuoto (-6 psi) per 15 min.
    4. Aggiungere DTT a tutti sopra buffer il giorno di utilizzo.
  3. Scongelare le celle dalla sezione 2 che contengono il costrutto di CENP-F. Regolare il volume a 40 mL con il buffer di GST-associazione. Aggiungere 1 millimetro DTT, 0,25 mM PMSF, 0,5 mM EDTA (soluzione madre 0.5 M, pH 8.0), 7mg benzamidine hydrochloride (1 mM) e metionina 40 mg D/L.
    Nota: Per ridurre la degradazione proteolitica, eseguire tutti i passaggi a 4 ° C, preferibilmente in una stanza fredda, se non specificato diversamente. Mantenere le cellule, lisati e frazioni della proteina purificata su ghiaccio in ogni momento e aggiungere gli inibitori della proteasi. Per prevenire l'ossidazione dei residui di cisteina e metionina, aggiungere riducenti come il DTT e metionina il giorno dell'esperimento. Per ridurre la degradazione proteolitica, lavorare attraverso i passi rapidamente.
  4. Lyse le cellule in un sonicatore come segue. Riempire un bicchiere di vetro con il lisato e immergetelo in acqua e ghiaccio. Sonicare la cultura (1 min 40 s, 100 W (50%) uscita/ampiezza, con 10 impulsi s e 10 cicli di riposo di s). Aggiungere 250 µM PMSF dopo sonicazione. Ispezionare il lysate delle cellule, che dovrebbe guardare più trasparente e non essere più viscoso.
  5. Chiaro il lisato mediante centrifugazione a 12.000-40.000 x g, 25 min, 4 ° C. Utilizzare provette per centrifuga fondo tondo e un rotore ad angolo fisso.
  6. Eseguire equilibrazione aggiungere 2 mL di glutatione agarosi 1:1 liquami a una colonna di cromatografia USA e getta. La colonna risultante avrà un volume di 1 mL. Lavare la colonna con 25 mL di acqua ultrapura e 25 mL di buffer di GST-associazione.
  7. Eseguire l'associazione come segue. Lavorando in una stanza fredda o la scatola fredda, decantare il lisato dai pellet. Filtrare il lisato (formato del poro di 0,2 µm) e versatela nella colonna collegata. La colonna di Cap e viene quindi incubato mentre delicatamente nutante per 30 min a 4 ° C.
  8. Lavare la colonna, metterla su un rack, lasciare che la resina stabilirsi e raccogliere il flusso attraverso. Lavare la colonna due volte con 25 mL di buffer di GST-associazione.
  9. Eluire tramite fenditura proteolitica.
    1. Collegare la colonna. Aggiungere 400 µ l di tampone di GST-associazione e 250 µ l di proteasi PS (2 mg/mL di brodo con un'attività di 1.000 U/mg, sia purificato in laboratorio o acquistato; Vedi Tabella materiali).
    2. La colonna di Cap e roteare delicatamente per risospendere la resina nel buffer. Incubare le colonne per 16-20 h a 4 ° C. Poi aggiungere 4 mL di tampone di GST-associazione per eluire il frammento di CENP-F proteolytically fenduto dalla colonna.
  10. Eluizione del glutatione
    1. Collegare la colonna, aggiungere 4 mL di tampone di eluizione di GST (4 volumi di colonna) e incubare per 10 min eluire il GST-tag associato. Raccogliere l'eluato. Rigenerare le colonne prima del riutilizzo come descritto dal produttore.
  11. Analizzare la frazione di eluizione di proteasi PS e la frazione di eluizione di glutatione da SDS-PAGE su gel di acrilammide 16%. Eseguire l'elettroforesi a 25 V/cm per 45 min. macchia i gel da Blue di Coomassie. La frazione di proteasi PS conterrà il frammento purificato di CENP-F, mentre la frazione di glutatione conterrà il GST-tag spaccato. Ispezionare il gel per valutare l'efficienza di taglio proteolitico.
  12. Concentrare il PS di eluato di proteasi a 0,5 mL utilizzando unità filtro centrifugo con un peso molecolare di 3 kDa taglio (Vedi Tabella materiali). Aggiungere l'eluato nel vano superiore del filtro e centrifugare esso in incrementi di 10-15 min a 4.100 x g, 4 ° C (rotore) concentrare il campione. Mescolare pipettando dopo ogni incremento.
  13. Collegare un adatto colonna di filtrazione del gel (Vedi Tabella materiali per informazioni sull'acquisto) ad un sistema di cromatografia in fase liquida (FPLC) proteine veloci ed equilibrare e con volume 1 colonna di gel filtrazione tampone.
  14. Centrifugare il frammento di CENP-F concentrato in una microcentrifuga (20min, 21.700 x g, 4 ° C). Iniettare il campione sulla colonna ed eluire esso con volume 1 colonna di gel filtrazione tampone. Raccogliere le frazioni 0,6 mL.
    Nota: Il buffer di gel filtrazione è ottimizzato per la compatibilità con l'analisi successiva della chinasi. Verificare se la proteina bersaglio è stabile in questo buffer. Se non è stabile, provare ad aggiungere più cloruro di sodio.
  15. Analizzare le frazioni di picco da SDS-PAGE (punto 3.11). Le frazioni di picco che contengono puro CENP-F frammenti della piscina. Concentrare i frammenti purificati di CENP-F a 3,3 mg/mL (passo 3.12). Analizzare i frammenti di CENP-F purificati da SDS-PAGE (punto 3.11).
  16. Determinazione di concentrazione nella proteina
    1. Diluire il campione 1: 100 in acqua ultrapura e posizionarlo in una micro-cuvette in quarzo. Registrare spettri in una gamma di lunghezza d'onda di 220-300 nm in uno spettrofotometro.
      Nota: La concentrazione di proteina c (mg/mL) è derivato dalla seguente equazione:
      Equation
  17. Fare 50 aliquote µ l della proteina purificata in microprovette da 0,5 mL e flash-congelare loro in azoto liquido. Conservare le aliquote a-80 ° C.

4. la purificazione della proteina ricombinante mediante cromatografia di affinità Ni-NTA

  1. Rendere i buffer seguenti e raffreddare a 4 ° C.
    1. Preparare la sua6-buffer obbligatorio utilizzando Tris 10 mM pH 8.0 a 25 ° C, 250 mM NaCl, 5 mM a pH imidazolo 8.0, 5mm BME. Aggiungere BME ai buffer di tutti il giorno di utilizzo.
    2. Preparare la sua6-tampone di lavaggio nello stesso modo come il suo6-associazione buffer ma utilizzando 20 mM imidazolo.
    3. Preparare la sua6-tampone di eluizione nello stesso modo come il buffer di associazione, ma utilizzando 150 mM imidazolo.
  2. Scongelare le cellule dalla sezione 2 che contengono il α di karyopherin costruire e regolare il volume a 40 mL con la sua6 -buffer obbligatorio. Aggiungere 5 mM BME, 0,250 mM PMSF, 7 mg benzamidine cloridrato (1 mM) e la metionina 40 mg D/L.
    1. Procedere come descritto ai punti 3.4-3.8 con le seguenti variazioni: utilizzare il suo6-buffer di associazione anziché buffer di GST-obbligatorio per tutti i passaggi. Invece di glutatione agarosi, utilizzare 4 mL dell'affinità di nichel gel (Vedi Tabella materiali) per rendere la colonna, che avrà un volume di colonna di 2 mL.
      Nota: Colonne di affinità di nichel sono incompatibili con DTT ed EDTA. Invece il gel di affinità di nichel, Ni2 +- nitrilotriacetico (NTA) l'acido dell'agarosi possono essere utilizzato, se la concentrazione di imidazolo in tampone di eluizione è aumentato a 250 mM (Vedi Tabella materiali).
  3. Lavare la colonne con 8 mL di sua6-tampone di lavaggio.
  4. Elute il α di karyopherin con 12 mL di suo6-eluizione buffer e analizzare eluato da SDS-PAGE (punto 3.11).
  5. Aggiungere 250 µ l di proteasi PS (punto 3.9) per l'eluato e incubare per 16-20 h a 4 ° C. Nel frattempo, Dializzare l'eluato due volte contro 1 L di suo6-buffer obbligatorio per 2-20 h, utilizzando una membrana di dialisi con taglio peso molecolare kDa 6-8.
  6. Rigenerare la colonna di gel di affinità di nichel come descritto dal produttore. Equilibrare la colonna con 25 mL di sua6-buffer obbligatorio. Aggiungere la proteina dializzata alla colonna ed effettuare il passaggio di associazione come descritto al punto 3.7.
  7. Raccogliere il flusso attraverso, che contiene il α di karyopherin purificato (con la sua6-tag clivata off) ed eluire la proteina rimanente con un ulteriore mL 4 dei suoi6-buffer obbligatorio. Queste frazioni della piscina. Eluire quindi le colonne con 12 mL di suo6-tampone di eluizione. Questa frazione contiene impurità.
  8. Analizzare il α di karyopherin ApoAlert e spaccati da passaggi 4.4-4.5 e le due frazioni di eluizione da questo passaggio di SDS-PAGE (punto 3.11) per valutare l'efficienza del suo6-tag clivaggio e purezza.
  9. Concentrare il α di karyopherin a 8 mg/mL e flash-congelamento in azoto liquido (passaggi 3.15-3,17).

5. l'analisi in Vitro della chinasi Cdk1/ciclina b

  1. Analisi in vitro della chinasi
    Nota: All'arrivo della chinasi, fare piccole aliquote, flash-congelamento in azoto liquido e conservarli a-80 ° C. Utilizzare entro 6 mesi. Mentre il peso molecolare è di 34 kDa per Cdk1 e 48 kDa per ciclina B, il peso molecolare apparente di ciclina B su SDS-PAGE è circa 60 kDa.
    1. Preparare i 10 x PK buffer (fornito con la chinasi) utilizzando 0.5 M Tris-HCl, 0.1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0,1% Brij 35, pH 7.5 a 25 ° C.
    2. Preparare i 10 x Stock in ATP: fare una soluzione di 4mm ATP in 1 x PK tampone e controllare il pH finale dello stock. Conservare in piccole aliquote a-20 ° C ed evitare cicli di gelo-disgelo.
    3. Frammento di mix 40 µ l di CENP-F (ad una concentrazione di 3,3 mg/mL o 400 µM), 6 µ l 10 x PK tampone, acqua ultrapura di 3 µ l, 6 µ l ATP 10x stock e 5 µ l umano Cdk1/ciclina B (1 µ g, 100 U) in una microprovetta 0,5 mL.
      Nota: Il frammento di CENP-F ha una massa molare di 8,6 kDa e quattro siti di fosforilazione Cdk1 specifici. Per un nuovo substrato, regolare la concentrazione di chinasi nel dosaggio secondo la concentrazione molare della proteina e secondo il numero di siti di fosforilazione. L'attività dello stock Cdk1/ciclina B ricombinante umano è 20.000 U/mL e l'attività specifica è 1.000.000 U / mg. 1 U è definito come la quantità di Cdk1/ciclina B necessaria per catalizzare il trasferimento di 1 pmol di fosfato al substrato di Cdk1 peptide PKTPKKAKKL-NH2 (50 µM) a 1 min a 30 ° C (Vedi Tabella materiali).
    4. Preparare una reazione di controllo senza Cdk1/ciclina B. Incubare le reazioni in un bagno d'acqua per 1-16 h a 30 ° C.
  2. Analizzare 2,5 µ l del dosaggio della chinasi e 2,5 µ l del controllo di SDS-PAGE (punto 3.11), utilizzando un gel con 16% di acrilammide. Per aumentare la risoluzione, estendere il tempo di esecuzione.
  3. Aggiungere un volume uguale di soluzione di cloridrato di 6m guanidina per la reazione di analisi della chinasi restante (e controllo). La concentrazione di cloridrato di guanidina finale sarà di 3 M. analizzare questi campioni mediante spettrometria di massa (sezione 6) per identificare i siti di fosforilazione o inviare i campioni ad un impianto di spettrometria di massa per l'analisi e quindi eseguire la funzione verifica ( Sezione 7).
    Nota: Per l'analisi di spettrometria di massa successivi, è molto importante che l'efficienza di fosforilazione dei siti individuali è più in alto possibile, preferibilmente 100%, altrimenti non è possibile mappare i siti di fosforilazione. Per migliorare notevolmente l'efficienza di fosforilazione, aggiungere grandi quantità di Cdk1/cyclin B e aumentare il tempo di incubazione di 16 h. La concentrazione di ATP può anche essere raddoppiata.
  4. Risoluzione dei problemi, è necessario eseguire un'analisi in vitro della chinasi di CENP-F (residui 2.987-3.065) come controllo positivo. Utilizzo di batch fresco di Cdk1/ciclina B con alta attività.

6. identificazione dei siti di fosforilazione Cdk1 specifici mediante spettrometria di massa

  1. Per denaturare e dissalare i campioni della proteina, eseguire microbore cromatografia liquida a fase inversa con una colonna di PLRP300.
  2. Per ottenere il numero di siti di fosforilazione nel frammento CENP-F, è necessario analizzare l'intatto in vitro fosforilato CENP-F 84-mer di spettrometria totale trappola ionica di ionizzazione electrospray (ESI-ITMS)44,45.
  3. Per valutare la posizione del sito acido phosphoamino di CENP-F, preparare il digest di tripsina in vitro fosforilato campioni della proteina CENP-F. Dissalare il digest di tripsina con punte di pipetta di desalificazione.
  4. Analizzare il trittico digest di CENP-F di ionizzazione electrospray Fourier transform spettrometria di massa a risonanza del ciclotrone dello ione (ESI-FTICR MS). Eseguire l'analisi su uno spettrometro di massa ESI-FTICR con un tempo di accumulo di 169 µs.
    Nota: La precisione delle masse determinata mediante ESI-FTICR MS è all'interno di 0,005 amu. Per quantificare il rapporto di ogni specie fosforilato rispettivi per la quantità di proteine totali, determinare le altezze dei picchi degli spettri totali.

7. Verifica funzionale: Test gli effetti delle mutazioni di Phosphomimetic sulle interazioni proteina-proteina di cromatografia di esclusione di dimensione analitica

Nota: per la verifica funzionale dei siti di fosforilazione Cdk1-specifici identificati, phosphomimetic mutanti di frammenti CENP-F sono stati creati sostituendo i siti di fosforilazione identificati con aspartati. La carica negativa dell'aspartato imita gli effetti della fosforilazione. Un mutante di S3048D del frammento CENP-F (residui 2.987-3.065) è stato creato.

  1. Per la verifica funzionale, confronta l'associazione di selvaggio-tipo e frammenti di phosphomimetic CENP-F di karyopherin α. utilizzano una cromatografia analitica come l'analisi di associazione. Per la cromatografia analitica, purificare CENP-F frammenti dalla cromatografia di affinità del glutatione (passaggi 3.1-3.12) e passare alla fase di filtrazione di gel.
  2. Concentrare la proteina a 5-6 mg/mL. Flash-congelare aliquote di proteina in azoto liquido (passaggi 3.15-3,17).
  3. Frammenti di Mix il purificato CENP-F (0,1 mg, selvaggio-tipo o la variante S3048D) e purificato karyopherin α (0,7 mg) in un rapporto molare 1:1. Regolare il volume del campione a 200 µ l con buffer di gel filtrazione. Incubare il campione per 30 min in ghiaccio, filtrare il campione (dimensione dei pori di 0,2 µm) e deselezionare il campione mediante centrifugazione (25 min, 21.700 x g, 4 ° C)
  4. Separare il campione di cromatografia di esclusione di formato (passaggi 3.13-3.14). Utilizzare un buffer di filtrazione gel composto da 20 mM HEPES, pH 7.5, 150 mM NaCl e 2 mM DTT. Eseguire gli esperimenti di filtrazione analitica gel in condizioni identiche per tutti i campioni.
  5. Calibrare la colonna di filtrazione analitica gel con gli standard di peso molecolare di massa molare nota come descritto dal produttore.
  6. Analizzare le frazioni di eluizione del 16% SDS-PAGE (punto 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Abbiamo recentemente utilizzato una in vitro analisi della chinasi (Figura 1) per identificare i siti di fosforilazione Cdk1 specifici in un frammento di CENP-F che conteneva un cNLS10. Questo segnale conferisce la localizzazione nucleare di CENP-F durante la maggior parte di interfase. Nella fase G2, CENP-F viene esportato dal nucleo al cytosol in modo Cdk1-dipendente. Per ottenere meccanicistici intuizioni su come Cdk1 regola la localizzazione cellulare di CENP-F, abbiamo analizzato la sequenza di CENP-F per predire i siti di fosforilazione Cdk1 specifici, utilizzando il server di iGPS36,37. All'interno del cNLS CENP-f, tre siti di fosforilazione Cdk1 specifici erano predisse a residui 3.042, 3045 e 3.048 (tabella 1). Un altro sito di fosforilazione Cdk1 specifico è stato previsto anche per residui 3.007 (tabella 1)10. Di conseguenza, abbiamo supposto che Cdk1 regola localizzazione CENP-F direttamente dalla fosforilazione della sua cNLS.

Per verificare se il cNLS CENP-f è un substrato per Cdk1, abbiamo effettuato un'analisi in vitro della chinasi con il frammento di CENP-F umano purificato (residui 2.987-3.065) e umano Cdk1/ciclina b. In vitro fosforilato CENP-F è stato analizzato il 16% SDS-PAGE, insieme con un controllo negativo che mancava la chinasi Cdk1 (Figura 2A)10. Per in vitro fosforilato CENP-F, uno spostamento chiaro verso l'alto è osservato per la banda sul gel rispetto al controllo negativo. Questo è tipico delle proteine fosforilate come ogni gruppo fosfato aggiunge due cariche negative e massa addizionale. Questi risultati indicano che CENP-F viene fosforilato da Cdk1/ciclina B10.

Per determinare il numero di siti di fosforilazione di CENP-F e quantificare l'efficacia di fosforilazione di questi siti, intatto in vitro fosforilato CENP-F frammento (84-mer) è stato analizzato da spettrometria di massa (ESI-ITMS)10. L'ESI-ion trap massa dello spettro osservato (Figura 2B) suggerisce che il frammento di CENP-F intatto è fosforilato a quattro siti (tabella 1)10.

La posizione dei siti fosforilati dell'amminoacido nella sequenza di CENP-F è stata valutata dall'esame triptico digest di ESI-FTICR Sig. ra tripsina fende catene proteiche dopo lisine e arginine e un digest di tripsina del frammento CENP-F ha provocato diversi peptidi, tra cui uno che conteneva residui 3.031-3, 052. Spettri di massa di questo peptide CENP-F erano costanti con la fosforilazione a residui T3042, T3045 e S3048, che si trovano all'interno del cNLS (tabella 1)10. Spettri di massa di un altro peptide triptico (residui 2.995-3.016) erano costanti con la fosforilazione a S3007 (tabella 1)10. Tutti i quattro siti di fosforilazione Cdk1 specifici sono stati anche previsto dalla sequenza. CDK1 specifici substrati contengono spesso una prolina accanto il residuo che è fosforilata6, come osservato per i residui T3042, T3045 e S3007. Si noti che S3048 è un sito di fosforilazione Cdk1 specifici un po' insolito, come una fenilalanina si trova accanto la serina. Per concludere, i risultati indicano che CENP-F è fosforilata specificamente ai residui 3.007, 3.042 e 3.045 3.048 dalla chinasi Cdk1. Tre di questi residui sono situati all'interno del cNLS CENP-f (tabella 1), che indica che Cdk1 può regolare la localizzazione cellulare di CENP-F attraverso la fosforilazione del cNLS nella fase G2, quando Cdk1 diventa attivo10.

Per verificare che questi siti di fosforilazione Cdk1 specifiche hanno una funzione fisiologica, abbiamo creato il phosphomimetic variante S3048D10. Phosphomimetic mutazioni imitano gli effetti della fosforilazione di residui caricati negativamente. Successivamente, abbiamo purificato la versione phosphomimetic del frammento CENP-F che conteneva il cNLS. Il cNLS CENP-f viene riconosciuto dal trasporto nucleare del ricevitore karyopherin α, che si lega con alta affinità ed è necessaria per l'importazione nucleare CENP-f. Per verificare se la mutazione di phosphomimetic indebolisce l'interazione tra il cNLS CENP-f con relativo trasporto nucleare del ricevitore karyopherin α, abbiamo effettuato un'associazione test (Figura 3)10. In questi esperimenti, un frammento purificato di CENP-F (wild-type o la variante S3048D) è stato mescolato con α karyopherin umano purificato, e la miscela è stata separata da cromatografia di esclusione di formato analitico. Inoltre, le proteine inoltre sono state analizzate singolarmente. Analisi di SDS-PAGE delle frazioni eluizione ha rivelato che il frammento di CENP-F di selvaggio-tipo con il cNLS interagisce fortemente con karyopherin α, poiché entrambe le proteine co-eluire (Figura 3)10. Tuttavia, solo una quantità trascurabile del frammento CENP-F S3048D associa a karyopherin α, e queste proteine eluire separatamente (Figura 3)10. Questi risultati suggeriscono che la fosforilazione del residuo 3.048 del cNLS CENP-f avrebbe un forte effetto sull'interazione con il trasporto nucleare di fattore α di karyopherin. Dovrebbe essere notato che tariffe di importazione nucleare dipendono altamente l'affinità di un segnale di localizzazione nucleare verso un trasporto nucleare fattore46, e di conseguenza, si prevede che queste mutazioni rallentano importazione nucleare10.

Figure 1
Figura 1: rappresentazione schematica della Cdk1 l'analisi in vitro della chinasi. Clicca qui per visualizzare una versione più grande di questa figura.

Figure 2
Figura 2: CENP-F viene fosforilato da Cdk1/ciclina B. (A) per identificare Cdk1 siti di fosforilazione specifici, un'analisi in vitro della chinasi è stata eseguita con purificato CENP-F (residui 2.987-3.065). Analisi di SDS-PAGE di un controllo negativo senza Cdk1/ciclina B sono mostrato nella corsia di sinistra (-Cdk1), accanto a in vitro fosforilato CENP-F nella corsia giusta (+ Cdk1). Standard di peso molecolare sono indicati. Si noti che lo spostamento verso l'alto di fosforilata CENP-F su SDS-PAGE, che è coerente con la fosforilazione di successo. CDK1 e ciclina B appaiono come bande deboli in 34 kDa e 60 kDa. (B) spettrometria di massa ESI-ion trap intatto fosforilato CENP-f da (A) è stata utilizzata per determinare il carico del fosfato della CENP-F fosforilato intatto (84-mer). Lo spettro di massa corrispondente è mostrato. L'intensità è tracciata contro il rapporto massa / carica (m/z). Lo spettro Mostra il + 10 a + 14 Stati di carica del frammento CENP-F intatto dopo fosforilazione. Esse indicano una popolazione di specie con 0, 1, 2, 3 e 4 esteri fosforici. Per quantificare il rapporto di ogni specie di quantità di proteine totali, le altezze di picco sono state determinate e rispetto (tabella 1). Questa figura è stata modificata da10 ed è stato riprodotto con il permesso dall'editore Taylor and Francis. Clicca qui per visualizzare una versione più grande di questa figura.

Figure 3
Figura 3: verifica funzionale: le mutazioni di phosphomimetic di CENP-F diminuiscono fortemente l'interazione con il trasporto nucleare del ricevitore karyopherin α. (AF) Purificato frammenti CENP-F (residui 2.987-3.065) (0,1 mg) e purificato karyopherin α (0,7 mg) e sono stati mescolati nel rapporto molare 1:1 e analizzati da cromatografia di esclusione di formato. I frammenti di CENP-F e karyopherin α inoltre sono stati analizzati singolarmente. Analisi di SDS-PAGE delle frazioni picco sono mostrato. Volumi di eluizione sono indicate sulla parte inferiore (in incrementi di 0,6 mL). Sulla sinistra, le posizioni delle bande di marcatore di peso molecolare e le loro messe in kDa sono indicate. Un asterisco segna tracce di residui GST (glutatione S-transferasi). (A) Karyopherin α. (B) profili di eluizione. L'assorbanza a 280 nm è tracciata contro il volume di eluizione. Il profilo di eluizione di karyopherin α (rosso) è overlaid con profili di eluizione di miscele di karyopherin α con frammenti di CENP-F (selvaggio-tipo: verde; phosphomimetic S3048D mutante: blu). Si noti che aggiunta del frammento selvaggio-tipo CENP-F sposta il volume di eluizione del picco α karyopherin di massa superiore, che è coerenza con l'associazione del frammento di selvaggio-tipo CENP-F. Questo spostamento non è osservato quando viene aggiunto il frammento di CENP-F con la mutazione di phosphomimetic S3048D, suggerendo che la mutazione di phosphomimetic diminuisce notevolmente l'interazione di CENP-F con karyopherin α. (C) frammento di selvaggio-tipo CENP-F (wt) e karyopherin α. (D) frammento di wt CENP-F. (E) CENP-F S3048D frammento e karyopherin α. frammento di S3048D CENP-F (F). Questa figura è stata creata con dati da10. Clicca qui per visualizzare una versione più grande di questa figura.

Tabella 1A. Sequenza del frammento CENP-F (residui 2987-3065) con predetto siti di fosforilazione Cdk1 specifici evidenziati dalla dimensione del carattere più grande. Triptici frammenti sono evidenziate in grassetto e sottolineati.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabella 1B. Analisi di spettrometria di massa della intatto CENP-F
mer 84 dopo fosforilazione in vitro con Cdk1/ciclina B
n # di siti di fosforilazione (P) rilevato Carico del fosfato espresso come % delle proteine totali
CENP-F 2987-3065 0P 6%
1 P 37%
2P 40%
3P 15%
4P 3%
Tabella 1 Analisi di spettrometria di massa dei peptidi triptici CENP-f dopo fosforilazione in vitro con Cdk1/ciclina B
n # di siti di fosforilazione Carico del fosfato
Fosfopeptide trittico, 0P 57%
residui di 2995-3016 1 P 43%
Fosfopeptide trittico, 0P 7%
residui di 3031-3052 1 P 64%
2P 29%
3P 1%

Tabella 1: Analisi di spettrometria del frammento CENP-F di massa dopo fosforilazione in vitro con Cdk1/ciclina B. Questa tabella è stata creata con dati da10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

La nostra analisi in vitro della chinasi sono un metodo molto potente per identificare bersagli molecolari per la chinasi Cdk1, che è un regolatore matrice del ciclo cellulare e regola molti processi cellulari importanti. Il metodo determina se una proteina purificata è un substrato per Cdk1 e permette l'identificazione di siti di fosforilazione specifici. Questo facilita gli studi meccanicistici per regolazione di processi cellulari da fosforilazione attraverso Cdk1.

Il fattore più critico per l'identificazione di successo dei siti di fosforilazione mediante spettrometria di massa è l'efficienza di fosforilazione del dosaggio della chinasi. L'efficienza di fosforilazione dei siti individuali dovrebbe essere più in alto possibile, preferibilmente 100%. Ciò può essere ottenuto aumentando la quantità di Cdk1/cyclin B e aumentando il tempo di incubazione per 16 h. Quando si calcola la quantità di Cdk1/ciclina B necessaria, la concentrazione molare della proteina e il numero di fosforilazione siti dovrebbero essere considerati. Ciò è particolarmente importante se sono presenti nella proteina bersaglio più siti di fosforilazione. Si deve inoltre osservare che l'attività di commercio Cdk1/ciclina B può variare da lotto a lotto, e che la chinasi può perdere rapidamente attività. Se la fosforilazione in vitro ha esito negativo, è consigliabile testare l'attività della chinasi. Come controllo positivo per la risoluzione dei problemi, può essere utilizzata in vitro la fosforilazione di CENP-F (residui 2.987-3.065). Come controllo negativo, una reazione senza aggiunta di Cdk1/ciclina B dovrebbe essere svolti ed analizzata. Un altro utile controllo negativo è l'uso di un mutante di chinasi-morti di Cdk1, che è cataliticamente inattivo a causa di una mutazione di punto semplice (D146N)47,48,49. Inoltre, per verificare i siti di fosforilazione identificati, può essere creata una versione phosphonegative della proteina bersaglio, dove i siti di fosforilazione sono sostituiti da alanine. Se i siti di fosforilazione identificati sono corretti, il mutante di phosphonegative corrispondente non può essere fosforilata in vitro.

Un semplice strumento per rilevare il successo fosforilazione della proteina dell'obiettivo è la semplice analisi dello spostamento del gel SDS-PAGE descritto qui. Proteine fosforilate in genere la migrazione più lenta su SDS-PAGE rispetto ai loro omologhi unphosphorylated, a causa della dimensione aggiunto e cariche negative. Si noti che per grandi proteine, ottimizzazione dell'analisi SDS-PAGE è necessaria per migliorare la risoluzione sufficiente a visualizzare lo spostamento del gel. Uno strumento utile per la separazione specifica delle proteine fosforilate è fosfato-associazione tag (Phos-tag) SDS-PAGE. Proteine fosforilate in un gel preparati con acrilammide Phos-tag sono visualizzati come bande più lenta migrazione rispetto ai corrispondenti defosforilata proteine50,51.

Per ottenere spettri di massa di alta qualità, è molto importante che la proteina per l'analisi in vitro della chinasi è puro e omogeneo. Il nostro protocollo di purificazione raggiunge questo combinando diversi passaggi di cromatografia altamente selettivo e impedendo la degradazione proteica e ossidazione attraverso l'aggiunta di inibitori della proteasi e riducenti. Il protocollo di purificazione può essere modificato per eluire la proteina di glutatione (cioè, con il GST-tag intatto); Tuttavia, dovrebbe essere considerato che il GST-tag aggiunge un altro 25 kDa, e grandi proteine sono difficili obiettivi per spettrometria di massa. In alternativa, il nostro protocollo di purificazione per sua6-proteine di fusione di tag possono essere utilizzati anche.

Questo protocollo può anche essere modificato per identificare i siti di fosforilazione che sono specifici per altre chinasi. L'unico requisito è che la chinasi purificata è sufficientemente stabili, attivo e disponibile. Condizioni di dosaggio necessario regolare per ogni chinasi ottenere la massima attività. Parametri per ottimizzare includono la quantità della chinasi, il tampone di reazione (pH, concentrazione di sale), tempo di incubazione, temperatura di reazione e concentrazione di ATP. Le analisi in vitro della chinasi sono state utilizzate con successo per identificare i siti di fosforilazione per molte delle chinasi compreso Kinases (chinasi polo-like)52,53,54e chinasi MAPK/ERK (proteina mitogene-attivata chinasi / extracellulare-segnale-regolato chinasi)55,56.

Mentre la forza di questo metodo è quello di identificare i siti di fosforilazione specifico in una proteina purificata, dovrebbe essere notato che un sito di fosforilazione che è un obiettivo per Cdk1 in vitro non può necessariamente essere fosforilata in vivo. A vivo, ulteriori meccanismi regolatori sono a posto, che potrebbe rendere inaccessibili per il riconoscimento di Cdk1 un sito di fosforilazione. Ad esempio, partner di interazione aggiuntiva può essere presente in vivo, che potrebbe nascondere un sito di fosforilazione o renderlo accessibile attraverso modifiche strutturali. Inoltre, il substrato deve colocalize con Cdk1/ciclina B nel nucleo nella fase G2 per essere fosforilato. Inoltre, modificazioni post-traduzionali o altri processi normativi potrebbero influenzare la conformazione del bersaglio della proteina in vivo, che potrebbe rendere inaccessibile un sito di fosforilazione. Questi limiti possono essere superati con la progettazione di esperimenti appropriati nelle celle o modelli animali che verificare che i siti di fosforilazione identificati hanno una funzione fisiologica. Qui, utilizziamo un'analisi di associazione semplice per la verifica funzionale, poiché fosforilazione diminuisce l'interazione di CENP-F con karyopherin α. Verifica funzionale deve essere eseguito anche nel contesto delle cellule o un modello animale. Di conseguenza, transfected anche proteine di fusione fluorescenti di CENP-F-frammenti contenuti del cNLS di cellule HeLa10. Le mutazioni di Phosphomimetic all'interno del cNLS CENP-f ha diminuito la localizzazione nucleare, che ha confermato una funzione fisiologica di questi siti di fosforilazione10.

Diversi strumenti sono disponibili per la verifica funzionale dei siti di fosforilazione in celle o modelli animali. Le mutazioni di Phosphomimetic, che mimano gli effetti della fosforilazione di cariche negative, sono ampiamente utilizzate per questo scopo. Per questi, il sito di fosforilazione (serina o treonina) viene sostituito da aspartato o glutammato. Il vantaggio è che solo una mutazione di punto della proteina dell'obiettivo è necessaria. Dovrebbe essere notato, che mentre le mutazioni phosphomimetic sono state utilizzate con successo in molti casi per la verifica funzionale, lavorano soprattutto nei casi in cui le modifiche carica il contributore predominante per regolamento piuttosto che un cambiamento strutturale. Phosphomimetic mutazioni non riescono a imitare gli effetti della fosforilazione in molti altri casi (ad es., 11). Tuttavia, altri approcci sono disponibili per la verifica funzionale dei siti di fosforilazione, compreso l'uso di phosphonegative mutazioni: queste mutazioni impediscono la fosforilazione sostituendo siti di fosforilazione con alanina. Un altro approccio utile per la verifica funzionale nel contesto cellulare è l'espressione di un mutante di chinasi-morti di Cdk1, che è inattivato da una mutazione di punto facile per introdurre (D146N)47,48,49. In particolare, diverse piccole molecole inibitori della Cdk1 sono commercialmente disponibili come Flavopiridol e RO-3306, che può essere utilizzato per studi funzionali in cellule o modelli animali7,8,11. Questi inibitori sono ben caratterizzati, e in studi clinici per il trattamento del cancro (per una recensione Vedi9) sono diversi.

Mentre un gran numero di siti di fosforilazione della proteina è stato identificato in studi di proteomica, la specificità della chinasi è nella maggior parte dei casi sconosciuta, e l'analisi in vitro della chinasi è uno dei pochi metodi disponibili per identificare i substrati di Cdk1. Sono stati utilizzati anche altri approcci. CDK1 obiettivi sono stati identificati utilizzando un enzima Cdk1 ingegnerizzato. Ha una grande tasca di associazione di substrato e accetta le versioni più ingombranti del trifosfato di adenosina come un substrato6. Questo substrato ingombrante non può associare a chinasi di selvaggio-tipo. L'aggiunta di ATP radiomarcato ingombranti a una cella estratto che contiene l'enzima Cdk1 modificata di conseguenza conduce per l'etichettatura specifica dei substrati diretti di Cdk1. 200 Cdk1 obiettivi sono stati identificati nel lievito gemmante con questo metodo; Tuttavia, non può essere applicato per cellule di mammifero, che è una limitazione fondamentale. In un altro studio, Cdk1 substrati sono stati identificati in cellule umane di esecuzione dell'analisi quantitativa fosfoproteomica con due piccole molecole inibitrici di Cdk1, Flavopiridol e RO-3306. 1215 fosfopeptidi su 551 proteine sono stati ridotti significativamente su Cdk1 inibitore aggiunta7. Questo metodo può schermare un intero proteoma per potenziali bersagli Cdk1, ma con conseguente necessità di obiettivi da verificare, ad esempio, da una chinasi in vitro test.

In futuro, l'analisi in vitro della chinasi probabilmente saranno combinato con schermi di throughput elevato per Cdk1 substrati che sono attualmente in fase di sviluppo. A causa del gran numero di substrati Cdk1 nel proteoma, umano Cdk1 molti substrati devono ancora essere identificati, e l'analisi in vitro della chinasi sarà uno strumento importante per identificare, mappa e verificare questi siti.

L'analisi in vitro della chinasi è un potente strumento per identificare gli obiettivi per la chinasi Cdk1 e per identificare i siti di fosforilazione specifici. L'identificazione di questi siti di fosforilazione consente studi meccanicistici per la regolazione dei processi cellulari di Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Gli autori non hanno nulla a rivelare.

Acknowledgments

Ringraziamo il Dr. David King, Howard Hughes Medical Institute, University of California a Berkeley per analisi di spettrometria di massa e utili commenti. Si ringrazia il Dr. Xuelian Zhu, Shanghai, istituti per le scienze biologiche, Accademia delle scienze cinese, Shanghai, Cina per la fornitura di un costrutto di CENP-F full-length. Infine, ringraziamo Dr. Susan Bane, Dr. Brian Callahan e Dr. Christof Grewer at Binghamton University per l'accesso alle apparecchiature. Questa ricerca è stata finanziata dalla Fondazione di ricerca per la State University di New York e il dipartimento di chimica, State University of New York at Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identificazione della chinasi Cyclin-dipendente 1 siti di fosforilazione specifico da una chinasi <em>In Vitro</em> test
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter