Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identificación de quinasa dependiente de ciclina 1 sitios específicos de fosforilación por una quinasa In Vitro ensayo

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Quinasa dependiente de ciclina 1 (Cdk1) está activado en la fase G2 del ciclo celular y regula muchas vías celulares. Aquí, presentamos un protocolo para un ensayo de quinasa en vitro con Cdk1, que permite la identificación de sitios de fosforilación de Cdk1 específicos para establecer dianas celulares de esta quinasa importante.

Abstract

Quinasa dependiente de ciclina 1 (Cdk1) es un regulador principal para el ciclo celular en todos los eucariotas y fosforila un estimado 8-13% del proteoma; sin embargo, el número de objetivos identificados para la Cdk1, particularmente en las células humanas es todavía bajo. La identificación de sitios de fosforilación de Cdk1 específicos es importante, ya que proporcionan penetraciones mecánicas en cómo Cdk1 controla el ciclo celular. Regulación del ciclo celular es esencial para la segregación cromosómica fiel, y defectos en este complicado proceso conducen a aberraciones cromosómicas y cáncer.

Aquí, describimos un ensayo en vitro kinasa que se utiliza para identificar sitios de fosforilación de Cdk1-específicos. En este ensayo, un purificado de la proteína está fosforilada en vitro por disponible en el comercio humano Cdk1/ciclina B. exitoso fosforilación es confirmada por SDS-PAGE, y sitios de fosforilación son identificados posteriormente por espectrometría de masas. También describimos protocolos de purificación que preparados de proteína altamente puro y homogéneo adecuados para el ensayo de quinasa y una prueba de enlace para la verificación funcional de los sitios de fosforilación identificados, que puntas de prueba de la interacción entre una señal de localización nuclear clásica (LNC) y su transporte nuclear receptor karyopherin α. Para ayudar con el diseño experimental, se revisan los enfoques para la predicción de sitios de fosforilación de Cdk1-específicos de secuencias de la proteína. Juntos estos protocolos presentan un enfoque muy potente que produce sitios de fosforilación de Cdk1-específicos y permite estudios mecanísticos en cómo Cdk1 controla el ciclo celular. Puesto que este método se basa en proteínas purificadas, pueden aplicarse a cualquier organismo y rendimiento confiables resultados del modelo, especialmente cuando se combinan con estudios funcionales de la célula.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Las quinasas son enzimas que transfiere grupos fosfato del ATP en sustratos y regulan muchos procesos celulares. Esta fosforilación es reversible, rápido, agrega dos cargas negativas y almacena la energía libre y es una de las modificaciones post-traduccionales más común utilizadas por las células. Cdk1, que también es conocido como homólogo de proteína 2 del ciclo de división celular (cdc2) es un controlador maestro para el ciclo celular en los eucariotas1,2,3,4,5y fosforila una Estimado 8-13% del proteoma6,7.

Aunque recientes estudios proteómicos han identificado muchos sitios de fosforilación en proteínas, en la mayoría de los casos, la quinasa responsable de estas modificaciones es desconocida. El número de conocidos destinos Cdk1, particularmente en las células humanas es baja7. La identificación de sitios de fosforilación de Cdk1 específicos es importante, ya que permite el estudio de mecanismos que establecen cómo Cdk1 controla el ciclo celular. Regulación del ciclo celular es importante para la segregación cromosómica fiel y la división celular, y una gran variedad de procesos celulares que ocurren para apoyar esta importante función fisiológica. Esto incluye detener la transcripción y la traducción antes del inicio de la mitosis, así como una dramática reorganización en la estructura celular y organización, como el desensamblaje de la envoltura nuclear, condensación del cromosoma y montaje del huso mitótico. Desregulación y errores en estos procesos causan cáncer, defectos de nacimiento o muerte mitótica de la célula. Inhibidores específicos de la Cdk1 como RO-3306 fueron desarrollados8, que proporcionan potentes herramientas para los estudios funcionales, y algunos de estos inhibidores están actualmente en ensayos clínicos para el tratamiento del cáncer (ver9 de revisión).

Aquí, describimos un análisis en vitro quinasa que permite la identificación de sitios de fosforilación de Cdk1-específicos. En este ensayo, disponible en el comercio humano Cdk1/ciclina B se utiliza para fosforilan un destino purificado proteína en vitro. Fosforilación de sustrato aumenta su masa y agrega dos cargas negativas; por lo tanto, acertada fosforilación es confirmada por un desplazamiento hacia arriba de la banda de gel de proteínas en SDS-PAGE. Sitios de fosforilación de CDK1-específicas se identifican posteriormente por análisis de espectrometría de masas de la proteína en vitro fosforilados. Para ayudar con el diseño experimental, también repasamos las herramientas computacionales y referencias para la predicción de sitios de fosforilación de Cdk1-específicos de la secuencia de la proteína. Además, también Describimos protocolos de purificación que preparados de proteína altamente puro y homogéneo adecuados para el análisis de la cinasa. Finalmente, los sitios de fosforilación identificada deben ser verificados por estudios funcionales, y aquí se describe un ensayo de enlace sencillo para ello. Combinado, esto es un enfoque muy potente que produce sitios de fosforilación de Cdk1-específicos y permite estudios mecanísticos en cómo Cdk1 controla el ciclo celular7,10,11. Puesto que este método se basa en proteínas purificadas, pueden aplicarse a cualquier organismo y rendimiento confiables resultados. Sin embargo, se recomienda la verificación funcional de los sitios la fosforilación obtenidos en vitro , como las células tienen mecanismos reguladores adicionales en su lugar, tales como modificaciones del posttranslational, socios de interacción o localización celular que puede representar sitios de fosforilación accesible o inaccesible para el reconocimiento de Cdk1.

CDK1 reconoce un sitio de fosforilación de consenso que consiste en (Ser/Thr-Pro-X-Lys/Arg), donde X es cualquier residuo y una serina o treonina es el sitio de fosforilación. Especialmente importante para el reconocimiento es la presencia de la prolina en la posición + 1. Además, se prefieren los residuos básicos en las posiciones + 2 o + 3, con más sitios de fosforilación específicos de Cdk1 contiene un Lys o Arg en el + 3 posición6,12.

Activación de Cdk1 es estrictamente regulada y conduce a la aparición de mitosis1,2,3,4,5. La actividad de Quinasas Ciclina-dependientes en general depende de su asociación con distintas ciclinas (ciclina A, B, C, D y E en seres humanos), que se expresan en el oscilante niveles durante todo el ciclo celular13. Expresión de CDK1 es constante durante todo el ciclo de la célula y la regulación de su actividad se basa en su asociación con las subunidades reguladoras ciclina A y ciclina B5,13,14,15, como así como las modificaciones post-traduccionales. Formación del complejo Cdk1/ciclina B se requiere para la cinasa activación5,14,15,16,17,18. En la fase G2, la ciclina B es traducido en el citosol e importado en el núcleo donde se une a Cdk15,14,15,16,17,18; sin embargo, Cdk1/ciclina B se mantiene inactiva por fosforilación en residuos Thr14 y Tyr15 por el humano Cdk1-inhibitorio quinasas Myt1 (quinasa cdc2-inhibitorio asociada a membrana tirosina y treonina-específico) y Wee1, respectivamente19, 20,21. En la fase G2 tardía, desfosforilación de Thr14 y Tyr15 por división celular ciclo 25 fosfatasa (cdc25) la actividad de la cinasa del complejo Cdk1/ciclina B activa y desencadena la iniciación de mitosis12,14, 18 , 20 , 22 , 23. fosforilación de Thr161 también se requiere para la activación de Cdk1/ciclina B y está mediada por Cdk7, la activación de Cdk quinasa (CAK)18. Degradación de la ciclina B en la anafase inactiva Cdk1, permitiendo la salida de mitosis24,25. Activación de Cdk1/ciclina B por lo tanto es un proceso complicado. El protocolo que presentamos se realiza comercialmente disponible Cdk1/ciclina B. Durante la expresión recombinante de este complejo en células de los insectos, es activado en vivo por quinasas endógeno14,20 y permanece activa en estado purificado. La resultante activa recombinante humano Cdk1/ciclina B es conveniente para en vitro el análisis de la cinasa.

Aquí, describimos un protocolo para la identificación de sitios de fosforilación de Cdk1-específicos en el centrómero humano proteína F (CENP-F)10. CENP-F es una proteína de cinetocoro que reside en el núcleo durante la mayor parte de la interfase (G1 y fase S) y se exporta al citosol en el G2 fase26,27,28 en un dependiente de la Cdk1 forma10, 11. localización nuclear es conferido por un bipartito LNC26. cNLSs son reconocidos por el transporte nuclear factor karyopherin α, que facilita, junto con karyopherin β y RanGDP, la importación de LNC-carga en el núcleo29. De las exportaciones nucleares en la fase G2 se facilitan a través de un camino desconocido de la exportación del10. Una vez que CENP-F se encuentra en el citosol, es reclutado a la envoltura nuclear y a su vez recluta la proteína motora dineína complejo30,31. Esta vía es importante en la posición del núcleo respectivo para el centrosoma durante etapas iniciales de ensamblaje del huso mitótico en una manera dependiente de la dineína, que es importante para la correcta sincronización de entrada mitotic y un proceso fundamental en el cerebro desarrollo30,31,32. A partir de la fase G2, CENP-F es también montado en el cinetocoro donde tiene importantes funciones para la fiel cromosoma segregación27,28,33,34,35 . Un paso clave de la regulación de estas vías es la exportación nuclear de CENP-F en la fase G2, que es dependiente de Cdk110,11. Describimos aquí un protocolo para la identificación de sitios de fosforilación de Cdk1-específicos en los LNCs de CENP-F. Phosphomimetic las mutaciones de estos sitios frenan importación nuclear de CENP-F, lo que sugiere que Cdk1/ciclina B regula directamente la localización celular de CENP-F por fosforilación de la LNC10.

En general, este análisis de la cinasa en vitro permite la identificación de sustratos específicos para las quinasa Cdk1. purificada blanco proteínas son fosforiladas en vitro por el complejo Cdk1/ciclina comercialmente disponible de la B y los sitios de fosforilación posteriormente son identificados por espectrometría de masas. La identificación de sitios de fosforilación de Cdk1 específicos apoya estudios mecanísticos que revelan cómo Cdk1 controla el ciclo celular.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. predicción de sitios de fosforilación de Cdk1-específicas de la secuencia de la proteína

  1. Antes de iniciar el análisis de la cinasa, analizar la secuencia de la proteína para sitios de fosforilación de Cdk1 específicos previstos y búsqueda de la literatura para los sitios de fosforilación experimentalmente establecido con especificidad desconocida quinasa. Utilice las siguientes herramientas, bases de datos y referencias que se resumen.
    1. Utilizar iGPS 3.0 software36,37 (http://gps.biocuckoo.org/online_full.php) para predecir sitios de fosforilación de Cdk1 específicos en la secuencia de la proteína objetivo. Utilice el enlace aquí para una predicción completa que incluye anotaciones de estructura secundaria y accesibilidad superficial.
    2. En el software, introduzca la secuencia de la proteína en formato FASTA. Especificidad de la cinasa, compruebe serina/treonina quinasa, CMGC, CDK, CDC2 CDK1y desmarcar otras especificidades. Seleccione mediano como el umbral y haga clic en el botón Enviar .
    3. Comparar los sitios previstos resultantes con el sitio de fosforilación de Cdk1 consenso (Ser/Thr-Pro-X-Lys/Arg).
    4. Importante, consulte el sitio previsto para la prolina junto a los residuos phosphorylated (algunos sustratos de Cdk1 son fosforilados en un sitio mínimo (Ser/Thr-Pro)6,12). Además, busque los residuos básicos, que son las preferidas en las posiciones + 2 o + 3, con más sitios de fosforilación de Cdk1 específicos que contiene una Lys o Arg en la posición + 36,12.
  2. También Compruebe que el sitio es accesible para el reconocimiento, como la presencia de un sitio web completo consenso no es suficiente para la fosforilación de Cdk1.
    1. Inspeccione la superficie accesibilidad y anotación de predicción de estructura secundaria en la salida de la IGP, que indica si el sitio se predice para ser accesible; N - y C-termini de proteínas son en muchos casos flexibles y accesibles para la fosforilación.
    2. Si se dispone de una estructura de rayos x de la proteína diana, comprobar accesibilidad de sitios putativos fosforilación mediante la inspección de su ubicación en la estructura.
  3. Busque la literatura para los sitios de fosforilación experimentalmente establecido con especificidad desconocida quinasa utilizando la base de datos de UniProtKB/Swiss-Prot38 (http://www.uniprot.org).
    1. Introduzca el nombre de la proteína en el cuadro de búsqueda y haga clic en el botón Buscar . Seleccione el orden correcto. Sitios de fosforilación son anotados y se hace referencia en la sección de modificaciones del aminoácido .
    2. Búsqueda de los estudios de Proteómica de extractos mitotic de la célula humana líneas7,39,40, que son particularmente útiles porque Cdk1 se convierte en activo en la fase G2 del ciclo celular.
  4. Identificar LNC bipartita por NLSmapper (opcional).
    Nota: Para las proteínas que transporte entre el citosol y el núcleo, un mecanismo común para la regulación de la localización celular es la fosforilación de un LNC bipartita en la posición-1 de lo principales motivo por Cdk1. La fosforilación suprime localización nuclear en el G2 fase10,41,42,43.
    1. Para tales proteínas mover, identificar el LNC en la secuencia de la proteína NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Pegue la secuencia de la proteína como texto en el cuadro de secuencia, seleccione un puntaje de corte de 5.0 y decide buscar la NLS de la toda la región. Pulse el botón de NLS de predecir .
    2. Comparar la LNC prevista resultante contra la secuencia consenso de un LNC bipartita, compuesta por el menor motivo (Lys-Arg), un enlazador de residuos por lo menos 10 y el motivo principal (Lys-Lys/Arg-X-Lys/Arg), donde X es cualquier residuo que no se carga negativamente .
    3. Compruebe si el sitio de fosforilación de Cdk1 predicho (*) se encuentra adyacente al motivo principal en la posición-1 de la máquina para hacer chorizos: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Nota: La fosforilación de un LNC bipartita en la posición-1 por Cdk1 se estableció como un mecanismo regulador de localización celular para varios mover proteínas10,41,42, 43.

2. expresión de proteínas recombinantes en Escherichia Coli

  1. Utilice la plásmidos de expresión de 2.1.1-2.1.2 pasos para la expresión de proteínas recombinantes en e. coli.
    1. Para crear la expresión humana de CENP-F (residuos de 2.987 3.065) construir, generar insertos por amplificar fragmentos de ADN por reacción en cadena de polimerasa (PCR) de una construcción integral de CENP-F (GenBank accesión: U19769.1). Utilice los siguientes primers: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG y AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Nota: El plásmido de CENP-F humano integral fue proporcionado generosamente por el Dr. Zhu X., institutos de ciencias biológicas, Academia China de Ciencias, Shanghai, China.
      1. Clonar el inserto en el vector pGEX6p1 con los sitios de restricción BamHI y XhoI. Utilice este plásmido para expresar proteínas de fusión N-terminal glutatión S-transferasa (GST) de CENP-F (residuos de 3.065 2.987).
        Nota: La etiqueta GST puede ser troceada apagado por la proteasa PreScission (en adelante denominada proteasa PS).
    2. Para el humano expresión de α karyopherin construir, generar insertos por amplificar fragmentos de DNA por PCR de una plantilla de cDNA integral karyopherin α2 (adhesión de secuencia NM_002264.3; primers: GCACTACATATGTCCACCAACGAGAATGCTAATA y TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Nota: Debido a la semejanza de las isoformas, esta construcción de α2 karyopherin se denomina en el texto subsiguiente karyopherin α.
      1. Clonar el inserto en el vector de pET28a-pres con los sitios de restricción NdeI y XhoI.
        Nota: Este es un vector de pET28a modificado en el que la secuencia de codificación para el sitio de clivaje de la trombina fue substituida por una secuencia que codifica para un sitio de la hendidura de proteasa PS. Utilizar este plásmido para expresar una proteína de fusión de karyopherin α con un N-terminal su6-etiqueta, donde el su6-etiqueta puede ser troceada apagado por proteasa de PS.
  2. Para crear las mutaciones de punto de una proteína objetivo, realizar mutagénesis sitio-dirigida con un kit.
  3. Expresan las proteínas recombinantes en e. coli para la posterior purificación.
    1. Realizar las acciones siguientes: kanamicina 50 mg/mL (1:1, 000 solución), cloranfenicol de 35 mg/mL 70% etanol (1:1, 000), ampicilina 100 mg/mL (1:1, 000), y 1 M isopropílico β-D-1-tiogalactopiranósido (IPTG; 1:5, 000).
    2. Estéril la acción del filtro y almacenar a-20 ° C. Evitar ciclos de congelación y descongelación repetida por IPTG.
    3. 1 μl del plásmido de expresión se transforman en 50 μl de células competentes de la 2 de Rosetta (DE3) pLysS cepa de e. coli , según las instrucciones del fabricante.
    4. Placa de la cultura en agar Luria-Bertani (LB) con cloranfenicol (35 LB μg/mL) y ampicilina (100 μg/mL LB) para la construcción de CENP-F, o cloranfenicol y kanamicina (cultura de 50 μg/mL) para la construcción α karyopherin. Incubar las placas durante 12-20 h a 37 ° C.
    5. Escoger una sola Colonia e inocular 50 mL de LB suplementado con antibióticos (ver paso 2.3.4). Incubar las planas agitando a 160-180 rpm durante 12-20 h a 37 ° C.
    6. Preparar 1 L de LB medio de 2.800 mL desconcertado matraz Fernbach. Hacer dos frascos para cada planas y autoclave ellos. Para permitir la aireación, no llene los matraces a más de dos tercios el matraz volumen. Matraces erlenmeyer pueden utilizarse así.
    7. Añadir antibióticos (paso 2.3.4) y 10 mL de una solución de glucosa filtrada estéril 40% (w/v) por 1 L de refrigerado lb Añadir 20 mL de planas por 1 L de medio LB.
      Nota: La absorbancia a 600 nm de un 1:10 dilución de las planas debe estar entre 0.15-0.2.
    8. Incube los frascos agitando a 160-180 rpm a 37 ° C. Medir la absorbancia a 600 nm de la cultura de las bacterias con regularidad. Si la absorbancia alcanza 0.5-0.6, inducen la expresión de proteínas mediante la adición de 0,2 mM IPTG (200 μL del stock de 1 M por 1 L de medio LB).
      Nota: Es importante que las células son inducidas a la correcta absorción. Generalmente toma 3-4 h para llegar a esta etapa.
    9. Incube los frascos agitando por 3 h a 37 ° C. Recoger las células por centrifugación (15 min, 4.100 x g, 4 º C, rotor swing-out). Deseche el sobrenadante. Vuelva a suspender los pellets de células en 20 mL de tampón de unión a GST (CENP-F) o su6-tampón de unión (karyopherin α) por 1 L de la cultura. Almacenar las células a-80 ° C.
      1. Preparar el buffer de GST-obligatoria (10 mM Tris pH 8.0 a 25 ° C, 150 mM NaCl, 1 mM Ditiotreitol (DTT), 0,5 mM EDTA) y sus6-binding buffer (10 mM Tris pH 8.0 a 25 ° C, 250 mM NaCl, 5 mM imidazol pH 8.0, 5 mM β-mercaptoetanol (BME)) por adelantado.

3. purificación de proteínas recombinantes por cromatografía de afinidad de glutatión y Gel filtración

  1. Realizar las acciones siguientes: 1 M TDT (1:1, 000 acciones, estéril filtrada con tamaño de poro de 0,2 μm y desgasificado); 250 mM phenylmethylsulfonyl el fluoruro (PMSF; 1:1,000 stock en dimetilsulfóxido). Almacenar a-20 ° C. Evitar ciclos de congelación y descongelación repetida.
  2. Hacer los siguientes buffers y enfriar a 4 ° C.
    1. Preparar el tampón de unión a GST con 10 mM de Tris pH 8,0 a 25 ° C, 150 mM NaCl, 1 mM TDT, 0,5 mM EDTA.
    2. Preparar el tampón de elución GST mediante 10 mM reducida glutatión (0.15 g/50 mL) disuelto en un buffer de 50 mM Tris, pH 8.0 a 25 ° C, 150 mM NaCl, 1 mM TDT. Confirmar que el pH del buffer final es 8.0 y utilice el mismo día que se hizo.
    3. Preparar el tampón de Gel filtración con 20 mM de Tris pH 7.5 a 25 ° C, 60 mM de NaCl, 2 TDT. Estéril del filtro el búfer con filtro superior de la botella (tamaño de poro de 0,2 μm). Desgasificar el búfer de agitación bajo vacío (-6 psi) durante 15 minutos.
    4. Añadir TDT a todos los búferes en el día de uso.
  3. Descongelar las células de la sección 2 que contienen la construcción de CENP-F. Ajustar el volumen a 40 mL con el tampón de unión a GST. Añadir 1 mM TDT, 0,25 mM PMSF, 0,5 mM de EDTA (solución de 0.5 M, pH 8.0), 7 mg de clorhidrato de benzamidine (1 mM) y 40 mg D/L metionina.
    Nota: Para reducir la degradación proteolítica, realice todos los pasos a 4 ° C, preferiblemente en un cuarto frío, a menos que se indique lo contrario. Mantener las células y lisados fracciones de proteína purificada en el hielo en todo momento y añadir inhibidores de la proteasa. Para evitar la oxidación de residuos de cisteína y metionina, añadir reductores como el DTT y metionina en el día del experimento. Para reducir la degradación proteolítica, trabajar a través de los pasos rápidamente.
  4. Lyse las células en un sonicador como sigue. Llene un vaso de vidrio con el lisado y sumergirlo en un baño de agua helada. Someter a ultrasonidos la cultura (1 min 40 s, a 100 W (50%) / amplitud de rendimiento, con 10 impulsos s y 10 s resto ciclos). Añadir 250 μm PMSF después de sonicación. Inspeccione el lysate de la célula, que debe buscar más transparente y no viscoso.
  5. Claro el lisado por centrifugación a 12.000-40.000 x g, 25 min, 4 ° C. Utilice tubos de centrífuga fondo redondo y un rotor de ángulo fijo.
  6. Realizar equilibrado añadiendo 2 mL de la mezcla de 1:1 de glutatión agarosa a una columna de cromatografía desechables. La columna resultante tendrá un volumen de 1 mL. Lavar la columna con 25 mL de agua ultrapura y 25 mL de tampón de unión a GST.
  7. Realizar los siguientes enlaces . Trabajo en un cuarto frío o caja fría, decantar el lisado de los pellets. Filtrar el lisado (tamaño de poro de 0.2 μm) y verter sobre la columna tapada. Tapa la columna e incubar mientras suavemente oscilante durante 30 min a 4 ° C.
  8. Lavar la columna, poner sobre una rejilla, dejar que la resina colocar y recoger el flujo a través. Lavar la columna dos veces con 25 mL de tampón de unión a GST.
  9. Procederá a la elución por clivaje proteolítico.
    1. Conecte la columna. Añadir 400 μL de tampón de unión a GST y 250 μl de proteasa PS (stock 2 mg/mL con una actividad de 1.000 U/mg, ya sea purificada en el laboratorio o adquirido; véase Tabla de materiales).
    2. La columna de la tapa y agitar suavemente para Resuspender la resina en el búfer. Incubar las columnas para 16-20 h a 4 ° C. Luego agregar 4 mL de tampón de GST-vinculante a fin de eluir el fragmento de CENP-F proteolytically hendido de la columna.
  10. Elución de glutatión
    1. Conecte la columna, agregar 4 mL de tampón de elución GST (4 volúmenes de columna) e incube durante 10 min eluir la GST-etiqueta encuadernada. Recoger el eluido. Regenerar las columnas antes de volver a utilizar según lo descrito por el fabricante.
  11. Analizar la fracción de elución de proteasa de PS y la fracción de elución de glutatión por SDS-PAGE de geles de acrilamida del 16%. Realizar electroforesis a 25 V/cm para 45 min tinción de los geles por azul de Coomassie. La fracción de proteasa PS contiene el fragmento purificado de CENP-F, mientras que la fracción de glutatión contiene la GST-etiqueta exfoliada. Inspeccione el gel para evaluar eficiencia de clivaje proteolítico.
  12. Concentrar el PS eluido de proteasa a 0,5 mL con filtro centrífugo unidades con un peso molecular de 3 kDa corte (véase Tabla de materiales). Añadir el efluente en el compartimiento superior del filtro y centrifugar en incrementos de 10-15 min a 4.100 x g, 4 º C (rotor swing-out) para concentrar la muestra. Mezclar mediante pipeteo después de cada incremento.
  13. Conectar una columna de filtración de gel del adecuado (véase Tabla de materiales por adquirir información) a un sistema de cromatografía líquida (FPLC) proteína rápida y equilibrar con volumen de 1 columna de gel filtración tampón.
  14. Centrifugue el fragmento de CENP-F concentrado en una microcentrífuga (20 min, 21.700 x g, 4 º C). Inyectar la muestra en la columna y eluir con volumen de 1 columna de gel filtración tampón. Recoger fracciones de 0.6 mL.
    Nota: El buffer de la filtración de gel está optimizado para la compatibilidad con el ensayo de quinasa posterior. Comprobar si la proteína Diana es estable en este buffer. Si no es estable, intenta añadir más cloruro de sodio.
  15. Analizar las fracciones de pico por SDS-PAGE (paso 3.11). Las fracciones de pico que contienen fragmentos de CENP-F puros de la piscina. Concentrar los fragmentos purificados de CENP-F a 3,3 mg/mL (paso 3.12). Analizar los fragmentos de CENP-F purificados por SDS-PAGE (paso 3.11).
  16. Determinación de la concentración de proteínas
    1. Diluir la muestra 1: 100 en agua ultrapura y colóquelo en una micro-cubeta de cuarzo. Registro espectros en un rango de longitud de onda de 220-300 nm en un espectrofotómetro.
      Nota: La concentración de proteína c (mg/mL) se deriva de la siguiente ecuación:
      Equation
  17. Hacer 50 alícuotas de μl de proteína purificada en microtubos de 0.5 mL y flash-congelación en nitrógeno líquido. Almacenar las alícuotas a-80 ° C.

4. purificación de proteínas recombinantes por cromatografía de afinidad Ni-NTA

  1. Hacer los siguientes buffers y enfriar a 4 ° C.
    1. Preparar la su6-tampón de Unión con 10 mM de Tris pH 8,0 a 25 ° C, 250 mM NaCl, 5 mM imidazol pH 8.0, 5 mM BME. Añadir BME a todos los búferes en el día de uso.
    2. Preparar la su6-tampón de lavado de la misma manera que su6-binding buffer pero con 20 mM de imidazol.
    3. Preparar la su6-tampón de elución en la misma forma que el tampón de Unión pero con 150 mM de imidazol.
  2. Descongelar las células de la sección 2 que contiene el α karyopherin construir y ajustar el volumen a 40 mL con el tampón de Unión6. Añadir 5 mM BME, 0,250 mM PMSF, 7 mg de clorhidrato de benzamidine (1 mM) y metionina 40 mg D/L.
    1. Proceda como se describe en los pasos 3.4-3.8 con las siguientes variaciones: Use su6-tampón de Unión en vez de tampón de GST-obligatorio para todos los pasos. En lugar de glutatión agarosa, utilizar 4 mL de la afinidad níquel gel (véase Tabla de materiales) para hacer la columna, que tendrá un volumen de columna de 2 mL.
      Nota: Columnas de afinidad níquel son incompatibles con la TDT y EDTA. En lugar del gel de afinidad níquel, Ni2 +- nitrilotriacético (NTA) el ácido agarosa permite, si se aumenta la concentración de imidazol en el tampón de elución a 250 mM (véase Tabla de materiales).
  3. Colada de la columnas con 8 mL de su6-tampón de lavado.
  4. Elute el α karyopherin con 12 mL de su6-elución del almacenador intermediario y analizar eluido por SDS-PAGE (paso 3.11).
  5. Añadir 250 μl de proteasa PS (paso 3.9) para el efluente e incube por 16-20 h a 4 ° C. Entretanto, dializan el efluente dos veces contra 1 L de su6-tampón de Unión para 2-20 h, utilizando una membrana de diálisis de 6-8 kDa peso molecular límite.
  6. Regenerar la columna de gel de afinidad níquel según lo descrito por el fabricante. Equilibrar la columna con 25 mL de su6-tampón de Unión. Añadir la proteína dializada a la columna y realizar el paso de enlace tal como se describe en el paso 3.7.
  7. Recoger el flujo a través, que contiene el α karyopherin purificada (con su6-etiqueta troceados apagado) y eluir la proteína restante con un adicional 4 mL de su6-tampón de Unión. Estas fracciones de la piscina. Luego eluir las columnas con 12 mL de su6-tampón de elución. Esta fracción contiene impurezas.
  8. Analizar el α karyopherin uncleaved y exfoliados de pasos 4.4-4.5 y las dos fracciones elución de este paso por SDS-PAGE (paso 3.11) para evaluar la eficacia de su6-hendidura y la pureza de la etiqueta.
  9. Concentrar el α karyopherin a 8 mg/mL y flash-congelación en nitrógeno líquido (pasos 3.15-3.17).

5. in Vitro ensayo quinasa Cdk1/ciclina b

  1. Ensayo de quinasa in vitro
    Nota: A la llegada de la cinasa, hacer pequeñas alícuotas, flash-freeze les en nitrógeno líquido y almacenarlas a-80 ° C. Utilizar dentro de 6 meses. Mientras que el peso molecular es 34 kDa para la Cdk1 y 48 kDa para la ciclina B, el peso molecular aparente de ciclina B en SDS-PAGE es alrededor de 60 kDa.
    1. Preparar 10 x PK búfer (suministrado con la quinasa) usando 0.5 M Tris-HCl, 0,1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0,1% Brij 35, pH de 7.5 a 25 ° C.
    2. Preparar 10 x stock ATP: hacer una solución de 4 mM de ATP en el 1 x de buffer de PK y compruebe el pH final de la acción. Almacenar en pequeñas alícuotas a-20 ° C y evitar ciclos de congelación-descongelación.
    3. Mix 40 μl de CENP-F fragmento (a una concentración de 3,3 mg/mL y 400 μm), de 6 μl 10 x tampón PK, 3 μl de agua ultrapura, 6 stock de x 10 de ATP μl y 5 μl de humano Cdk1/ciclina B (1 μg, 100 U) en un microtubos de 0.5 mL.
      Nota: El fragmento de CENP-F tiene una masa molar de 8,6 kDa y cuatro sitios de fosforilación de Cdk1-específicos. Para un sustrato nuevo, ajustar la concentración de cinasa en el ensayo según la concentración molar de la proteína y según el número de sitios de fosforilación. La actividad de la población de Cdk1/ciclina B recombinante humana es 20.000 U/mL y la actividad específica es 1.000.000 U / mg. 1 U se define como la cantidad de Cdk1/ciclina B necesaria para catalizar la transferencia de 1 pmol de fosfato a Cdk1 sustrato de péptido PKTPKKAKKL-NH2 (50 μm) en 1 min a 30 ° C (véase Tabla de materiales).
    4. Preparar una reacción de control sin Cdk1/ciclina B. Incubar las reacciones en un baño de agua de 1-16 h a 30 ° C.
  2. Analizar 2.5 μl de la reacción del ensayo de quinasa y 2,5 μl del control por SDS-PAGE (paso 3.11), utilizando un gel con 16% de acrilamida. Para aumentar la resolución, ampliar el tiempo de ejecución.
  3. Añadir un volumen igual de solución de clorhidrato de guanidina de 6 M para la reacción de ensayo quinasa restantes (y el control). La concentración de clorhidrato de guanidina final será de 3 M. analizar estas muestras por espectrometría de masas (sección 6) para identificar los sitios de fosforilación o enviar las muestras a un centro de espectrometría de masas para análisis y luego realizar verificación () función Sección 7).
    Nota: Para el análisis de espectrometría de masas posteriores, es muy importante que la eficiencia de la fosforilación de los sitios individuales es tan alta como sea posible, preferiblemente 100%, según los sitios de fosforilación no se puede asignar. Para mejorar significativamente la eficiencia de la fosforilación, añadir grandes cantidades de Cdk1/ciclina B y aumentar el tiempo de incubación a las 16 h. También puede duplicar la concentración de ATP.
  4. Para solucionar problemas, realizar un análisis de la cinasa en vitro de CENP-F (residuos de 2.987 3.065) como control positivo. Utilice lotes frescos de Cdk1/ciclina B con actividades de alto.

6. identificación de sitios específicos de Cdk1 fosforilación por espectrometría de masas

  1. Para desnaturalizar y desalar las muestras de proteína, realizar microbore cromatografía líquida de fase reversa con una columna de PLRP300.
  2. Para obtener el número de sitios de fosforilación en el fragmento de CENP-F, análisis de la intacta en vitro fosforilada CENP-F 84-mer por espectrometría de masas de trampa iónica de ionización de electrospray (ESI-ITMS)44,45.
  3. Para determinar la ubicación del sitio ácido phosphoamino de CENP-F, preparar los resúmenes de la tripsina de la en vitro fosforila las muestras de proteína CENP-F. Desalar los resúmenes de la tripsina con puntas de pipeta de la desalación.
  4. Analizar los resúmenes trípticos de CENP-F por ionización de electrospray Fourier transforma spectrometry del total de la resonancia de ion ciclotrón (ESI-FTICR MS). Efectuar el análisis en un espectrómetro de masas ESI-FTICR con un tiempo de acumulación de 169 μs.
    Nota: La exactitud de masas determinadas por ESI-FTICR MS es de 0,005 amu. Para cuantificar la proporción de cada especie fosforilada correspondiente a la cantidad de proteína total, determinar las alturas de pico de los espectros de masas.

7. Verificación funcional: Pruebas los efectos de las mutaciones Phosphomimetic en las interacciones de proteínas por cromatografía por exclusión de tamaño analítico

Nota: para la verificación funcional de los sitios de fosforilación de Cdk1 específicos identificados, phosphomimetic mutantes de CENP-F fragmentos fueron creados mediante la sustitución de los sitios de fosforilación identificados con aspartato. La carga negativa de aspartato imita los efectos de la fosforilación. Un mutante de S3048D del fragmento del CENP-F (residuos de 2.987 3.065) fue creado.

  1. Para la verificación funcional, comparar la Unión de tipo salvaje y fragmentos phosphomimetic CENP-F karyopherin α. utilizan una filtración de gel analítica como la prueba enlace. Para la filtración de gel analítica, purificar fragmentos CENP-F por cromatografía de afinidad de glutatión (pasos 3.1-3.12) y omitir el paso de filtración de gel.
  2. Concentrado de la proteína 5-6 mg/ml. Flash-congelar alícuotas de proteína en nitrógeno líquido (pasos 3.15-3.17).
  3. Mezcla el CENP-F purificada fragmentos (0,1 mg, tipo salvaje o la variante S3048D) y purificada karyopherin α (0,7 mg) en una proporción molar 1:1. Ajustar el volumen de muestra a 200 μL con tampón de la filtración de gel. Incubar la muestra durante 30 minutos en hielo, filtrar la muestra (tamaño de poro de 0,2 μm) y claro la muestra por centrifugación (25 min, 21.700 x g, 4 ° C)
  4. Separar la muestra por cromatografía por exclusión de tamaño (pasos 3.13 3.14). Utilizar un búfer de filtración de gel que consta de 20 mM HEPES, pH 7.5, 150 mM NaCl y 2 mM DTT. Realizar los experimentos de filtración analítica gel bajo condiciones idénticas para todas las muestras.
  5. Calibrar la columna de filtración de gel analítica con los estándares de peso molecular de masa molar conocida según lo descrito por el fabricante.
  6. Analizar las fracciones elución en un 16% SDS-PAGE (paso 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Recientemente hemos utilizado un en vitro ensayo quinasa (figura 1) para identificar sitios de fosforilación de Cdk1 específicos en un fragmento de CENP-F que contenía un LNC10. Esta señal le confiere localización nuclear de CENP-F durante la mayor parte de la interfase. En la fase G2, CENP-F se exporta del núcleo en el citosol en forma dependiente de Cdk1. Para obtener ideas mecanicistas sobre cómo Cdk1 regula la localización celular de CENP-F, se analizó la secuencia de CENP-F predecir sitios de fosforilación de Cdk1-específicos, usando el servidor de iGPS36,37. Dentro de la LNC de CENP-F, tres sitios de fosforilación de Cdk1 específicos fueron predichos en los residuos 3.042, 3045 y 3.048 (tabla 1). Otro sitio de fosforilación de Cdk1 específico también fue predicho para residuo 3.007 (tabla 1)10. Por lo tanto, la hipótesis de que la Cdk1 regula localización de CENP-F directamente por fosforilación de la LNC.

Para probar si las LNCs de CENP-F es un sustrato para la Cdk1, realizamos un análisis de la cinasa en vitro con el fragmento purificado de CENP-F humano (residuos de 2.987 3.065) y humano Cdk1/ciclina B. In vitro fosforilada CENP-F se analizó en el 16% SDS-PAGE, junto con un control negativo que carecía de la quinasa Cdk1 (figura 2A)10. Para en vitro había fosforilada CENP-F, se observa un cambio claro hacia arriba de la banda en el gel en comparación con el control negativo. Esto es típico de proteínas fosforiladas como cada grupo fosfato añade dos cargas negativas y masa adicional. Estos resultados sugieren que el CENP-F es fosforilado por Cdk1/ciclina B10.

Para determinar el número de sitios de fosforilación de CENP-F y para cuantificar la eficiencia de la fosforilación de estos sitios, el intacta en vitro fosforilada fragmento CENP-F (84-mer) fue analizado por espectrometría de masas (ESI-ITMS)10. El espectro de masas de trampa (figura 2B) de ESI-ion que se observado sugiere que el fragmento intacto del CENP-F es fosforilado en cuatro sitios (tabla 1)10.

La ubicación de los sitios fosforilados del aminoácido en la secuencia de CENP-F fue evaluada mediante el examen resúmenes trípticos por ESI-FTICR Sra. tripsina escinde cadenas de proteínas después de lisinas y arginines, y un resumen de la tripsina del fragmento del CENP-F dio lugar a varios péptidos, incluyendo uno que contenía residuos de 3.031-3, 052. Espectros de masas de este péptido de CENP-F eran constantes con la fosforilación en residuos T3042 T3045 y S3048, que se encuentran dentro de la LNC (tabla 1)10. Espectrometría de masas de otro péptido tríptico (residuos 2.995-3.016) era constante con la fosforilación en el S3007 (tabla 1)10. Todos cuatro sitios de fosforilación de Cdk1 específicos también se predijeron de la secuencia. Sustratos específicos de CDK1 contienen a menudo una prolina junto a los residuos que es fosforilada6, como observó residuos T3042 T3045 y S3007. Cabe señalar que S3048 es un sitio de fosforilación de Cdk1 específico algo inusual, como una fenilalanina está situado al lado de la serina. Para concluir, los resultados sugieren que CENP-F es específicamente fosforilada en residuos 3.007, 3.042, 3.045 y 3.048 por la quinasa Cdk1. Tres de estos residuos se encuentran dentro de la LNC de CENP-F (tabla 1), indicando que Cdk1 puede regular la localización celular de CENP-F a través de la fosforilación de la LNC en la fase G2, cuando Cdk1 se convierte en activo10.

Para verificar que estos sitios de fosforilación de Cdk1 específicos tienen una función fisiológica, hemos creado el phosphomimetic variante S3048D10. Mutaciones de Phosphomimetic mímico los efectos de la fosforilación de residuos cargados negativamente. A continuación, nos purifica la versión phosphomimetic del fragmento del CENP-F que contiene el LNC. La LNC de CENP-F es reconocida por el transporte nuclear receptor karyopherin α, que se une con alta afinidad y se requiere para la importación nuclear de CENP-F. Para probar si la mutación phosphomimetic debilita la interacción entre el LNC de CENP-F con su transporte nuclear receptor karyopherin α, se realizó una Unión de ensayo (figura 3)10. En estos experimentos, un fragmento purificado de CENP-F (el tipo salvaje o la variante S3048D) se mezcló con α karyopherin humano purificado, y la mezcla se separa por cromatografía por exclusión de tamaño analítico. Además, las proteínas también se analizaron individualmente. Análisis de SDS-PAGE de las fracciones elución reveló que el fragmento de tipo salvaje CENP-F con la LNC interacciona fuertemente con karyopherin α, ya que ambas proteínas responsables Co (figura 3)10. Sin embargo, sólo una cantidad insignificante del fragmento del CENP-F S3048D se une a karyopherin α, y estas proteínas responsables por separado (figura 3)10. Estos resultados sugieren que la fosforilación de residuos de 3.048 de LNC de CENP-F tendría un fuerte efecto sobre la interacción con el factor transporte nuclear karyopherin α. Cabe señalar que las tasas de importación nuclear dependen mucho de la afinidad de una señal de localización nuclear hacia un transporte nuclear factor46, y por lo tanto, se espera que estas mutaciones frenar importación nuclear10.

Figure 1
Figura 1: representación esquemática del Cdk1 en vitro ensayo quinasa. Haga clic aquí para ver una versión más grande de esta figura.

Figure 2
Figura 2: CENP-F es fosforilado por Cdk1/ciclina B. (A) identificar Cdk1 sitios de fosforilación específicos, un análisis de la cinasa en vitro realizó con CENP-F purificada (residuos de 3.065 2.987). Análisis de SDS-PAGE de un control negativo sin Cdk1/ciclina B se muestran en el carril de la izquierda (-Cdk1), junto a en vitro fosforilada CENP-F en el carril derecho (+ Cdk1). Estándares de peso molecular están indicadas. Tenga en cuenta el cambio ascendente de CENP-F fosforilada en SDS-PAGE, que es consistente con la fosforilación de éxito. CDK1 y ciclina B aparecen como bandas débiles de 34 kDa y 60 kDa. (B) espectrometría de masas ESI-ion trampa intacta fosforilada CENP-f de (A) se utilizó para determinar la carga de fosfato de la CENP-F fosforilada intacta (84-mer). Se muestra el espectro de masas correspondiente. La intensidad se grafica contra la relación masa / carga (m/z). El espectro muestra el + 10 a + 14 Estados de carga del fragmento del CENP-F intacto después de la fosforilación. Indican una población de especies con 0, 1, 2, 3 y 4 ésteres de fosfato. Para cuantificar la proporción de cada especie a la cantidad de proteína total, las alturas de pico se determinaron y compararon (tabla 1). Esta cifra se ha modificado de10 y fue reproducida con permiso de editorial Taylor y Francis. Haga clic aquí para ver una versión más grande de esta figura.

Figure 3
Figura 3: Verificación funcional: las mutaciones phosphomimetic de CENP-F disminuyen fuertemente la interacción con el receptor transporte nuclear karyopherin α. (AF) Purificar fragmentos de CENP-F (residuos de 2.987 3.065) (0,1 mg) y purificada karyopherin α (0,7 mg) y se mezclaron en relación molar 1:1 y analizadas por cromatografía por exclusión de tamaño. Los fragmentos de CENP-F y α karyopherin también fueron analizados individualmente. Se muestran el análisis de SDS-PAGE de las fracciones de pico. Volúmenes de elución se indican en la parte inferior (en incrementos de 0,6 mL). A la izquierda, se indican posiciones de bandas del marcador de peso molecular y sus masas en kDa. Un asterisco marca huellas de GST residual (glutatión S-transferasa). (A) Karyopherin α. (B) perfiles de elución. La absorbancia a 280 nm se grafica versus el volumen de elución. El perfil de elución para karyopherin α (rojo) es overlaid con perfiles de elución de las mezclas de karyopherin α con fragmentos de CENP-F (tipo: verde; phosphomimetic S3048D mutante: azul). Tenga en cuenta que además del fragmento de tipo salvaje CENP-F cambia el volumen de elución del pico karyopherin α a mayor masa, que es consistente con el atascamiento del fragmento de tipo salvaje del CENP-F. Este cambio no se observa cuando se añade el fragmento de CENP-F con la mutación de phosphomimetic S3048D, lo que sugiere que la mutación de phosphomimetic disminuye grandemente la interacción de CENP-F con karyopherin α. (C) fragmento CENP-F de tipo salvaje (wt) y karyopherin α. (D) fragmento de wt CENP-F. (E) S3048D de CENP-F fragmento y karyopherin α. (F) CENP-F S3048D fragmento. Esta figura fue creada con datos de10. Haga clic aquí para ver una versión más grande de esta figura.

Tabla 1A. Secuencia del fragmento CENP-F (residuos 2987-3065) con previsto sitios de fosforilación de Cdk1 específicos destacados por tamaño de letra más grande. Fragmentos de trípticos están resaltadas en negrita y subrayados.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabla 1B. Análisis de espectrometría de masas de la CENP-F intacta
84 mer después en vitro la fosforilación con Cdk1/ciclina B
# de sitios de fosforilación (P) detectado Carga de fosfato expresado como % de proteína total
CENP-F 2987-3065 P 0 6%
1 P 37%
2P 40%
3P 15%
4P 3%
Tabla 1 Análisis de espectrometría de masas de péptidos trípticos de CENP-F después en vitro la fosforilación con Cdk1/ciclina B
# de sitios de fosforilación Carga de fosfato
Fosfopéptidos trípticos, P 0 57%
residuos 2995-3016 1 P 43%
Fosfopéptidos trípticos, P 0 7%
residuos 3031-3052 1 P 64%
2P 29%
3P 1%

Tabla 1: Análisis de espectrometría del fragmento del CENP-F en masa después en vitro la fosforilación con Cdk1/ciclina B. Esta tabla fue creada con datos de10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Nuestro análisis de la cinasa en vitro es un método muy de gran alcance para identificar dianas moleculares para la quinasa Cdk1, que es un regulador maestro del ciclo celular y regula muchos procesos celulares importantes. El método determina si una proteína purificada es un sustrato para la Cdk1 y permite la identificación de sitios de fosforilación específicos. Esto facilita el estudio de mecanismos para la regulación de procesos celulares por fosforilación a través de Cdk1.

El factor más crítico para la identificación acertada de los sitios de fosforilación por espectrometría de masas es la eficiencia de la fosforilación del ensayo quinasa. La eficiencia de la fosforilación de los sitios individuales debe ser tan alta como sea posible, preferiblemente 100%. Esto puede lograrse aumentando la cantidad de Cdk1/ciclina B y que aumentar el tiempo de incubación a las 16 h. Al calcular la cantidad de Cdk1/ciclina B es necesitada, la concentración molar de la proteína y el número de sitios deben ser considerados la fosforilación. Esto es especialmente importante si hay múltiples sitios de fosforilación de la proteína diana. Debe señalarse también que la actividad de comercial Cdk1/ciclina B puede variar de lote a lote, y que la cinasa puede perder actividad rápidamente. Si en vitro la fosforilación es infructuoso, se recomienda probar la actividad de la quinasa. Como control positivo para la solución de problemas, se puede utilizar en vitro la fosforilación de CENP-F (residuos de 3.065 2.987). Como control negativo, una reacción sin adición de Cdk1/ciclina B debe ser realizada y analizada. Otro control negativo útil es el uso de una mutante de quinasa-muertos de Cdk1, que es catalíticamente inactivo, debido a una mutación de punto simple (D146N)47,48,49. Además, para verificar sitios de fosforilación identificados, una versión phosphonegative de la proteína diana puede crearse, donde los sitios de fosforilación son sustituidos por alanines. Si los sitios de fosforilación identificados son correctos, el mutante de phosphonegative correspondiente no puede ser fosforilada in vitro.

Una sencilla herramienta para detectar éxito fosforilación de la proteína Diana es el ensayo de cambio de gel de SDS-PAGE simple descrito aquí. Proteínas fosforiladas migran normalmente más lento en SDS-PAGE que sus contrapartes unphosphorylated, debido al mayor tamaño y cargas negativas. Tenga en cuenta que las proteínas grandes, optimización del análisis de SDS-PAGE es necesaria para mejorar la resolución suficiente para visualizar el cambio de gel. Una herramienta útil para la separación específica de proteínas fosforiladas es enlace de fosfato tag (etiqueta de Phos) SDS-PAGE. Las proteínas fosforiladas en un gel preparado con acrilamida Phos-tag se visualizan como bandas migrando más lentamente en comparación con la correspondiente defosforilaciones proteínas50,51.

Para obtener los espectros de masas de alta calidad, es muy importante que la proteína para el análisis de la cinasa en vitro es puro y homogéneo. Nuestro protocolo de purificación logra esto mediante la combinación de varios pasos de cromatografía altamente selectivo y previniendo la degradación de las proteínas y la oxidación mediante la adición de inhibidores de la proteasa y reductores. El protocolo de purificación puede ser modificado para eluir la proteína por glutatión (es decir, con la GST-etiqueta intacta); sin embargo, debe considerarse que la GST-etiqueta añade otra de 25 kDa y proteínas grandes son difíciles objetivos para espectrometría de masas. Por otra parte, nuestro protocolo de purificación para su6-proteínas de fusión de la etiqueta también se pueden utilizar.

Este protocolo puede modificarse también para identificar sitios de fosforilación que son específicos para otras quinasas. El único requisito es que la quinasa purificada está disponible, activo y lo suficientemente estable. Condiciones del ensayo deben ajustarse para que cada quinasa lograr la máxima actividad. Parámetros a optimizar son la cantidad de la cinasa, buffer de reacción (pH, concentración de sal), tiempo de incubación, temperatura de reacción y concentración de ATP. Ensayos de quinasa in vitro se han utilizado con éxito para identificar sitios de fosforilación para muchas quinasas incluyendo Plks (polo-como quinasas)52,53,54y quinasas ERK/MAPK (proteína quinasa activada quinasas / extracelular regulada por señal quinasas)55,56.

Mientras que la fuerza de este método es identificar sitios específicos de fosforilación de una proteína purificada, debe señalarse que un sitio de fosforilación que es un objetivo de Cdk1 in vitro no necesariamente puede ser fosforilada in vivo. En vivo, mecanismos regulatorios adicionales están en su lugar, que podría hacer un sitio de fosforilación inaccesibles para el reconocimiento de Cdk1. Por ejemplo, los socios adicionales de interacción pueden ser presente en vivo, que podría ocultar un sitio de fosforilación o que sea accesible a través de cambios estructurales. Además, el sustrato debe colocalize con Cdk1/ciclina B en el núcleo en la fase G2 para ser phosphorylated. Además, las modificaciones post-traduccionales u otros procesos normativos podrían impactar la conformación del destino proteína en vivo, que podría hacer un sitio de fosforilación inaccesibles. Estas limitaciones pueden superarse mediante el diseño de experimentos apropiados en las células o en modelos animales que compruebe que los sitios de fosforilación identificados tienen una función fisiológica. Aquí, utilizamos un análisis de la simple unión de verificación funcional, puesto que la fosforilación disminuye la interacción de CENP-F con karyopherin α. funcional verificación debe realizarse también en el contexto de las células o en un modelo animal. Por lo tanto, también nosotros transfected las proteínas fluorescentes de fusión de CENP-F-fragmentos que contenían el LNC en células de HeLa10. Phosphomimetic mutaciones dentro de la LNC de CENP-F disminuyen localización nuclear, lo que confirmó una función fisiológica de estos sitios de fosforilación10.

Varias herramientas están disponibles para la verificación funcional de sitios de fosforilación en las células o en modelos animales. Las mutaciones de Phosphomimetic, que imitan los efectos de la fosforilación por cargas negativas, son ampliamente utilizadas para este propósito. Para éstos, el sitio de fosforilación (serina o treonina) se sustituye por aspartato o glutamato. La ventaja es que sólo una mutación de punto de la proteína Diana es necesaria. Cabe señalar, que mientras que las mutaciones phosphomimetic fueron utilizadas con éxito en muchos casos para la verificación funcional, especialmente trabajar en casos donde los cambios de carga son el contribuyente predominante para regulación en lugar de un cambio estructural. Phosphomimetic mutaciones no imitar los efectos de la fosforilación en muchos otros casos (por ejemplo, 11). Sin embargo, existen otros enfoques para verificación funcional de sitios de fosforilación, incluyendo el uso de las mutaciones phosphonegative: estas mutaciones impedir fosforilación mediante la sustitución de sitios de fosforilación con alanina. Otro enfoque útil para la verificación funcional en el contexto celular es la expresión de un mutante de la cinasa-muertos de Cdk1, que es inactivado por una mutación de punto fácil de introducir (D146N)47,48,49. En particular, varios inhibidores de Cdk1 de molécula pequeña son comercialmente disponibles como derivados y RO-3306, que puede ser utilizado para estudios funcionales en las células o en modelos animales7,8,11. Estos inhibidores están bien caracterizados, y varios están en ensayos clínicos para el tratamiento de cáncer (para una revisión ver9).

Mientras que un gran número de sitios de fosforilación de proteínas se han identificado en estudios proteómicos, la especificidad de la quinasa es en la mayoría de los casos desconocida, y el ensayo de quinasa en vitro es uno de los pocos métodos disponibles para identificar sustratos de Cdk1. También se han utilizado otros métodos. CDK1 objetivos fueron identificados mediante el uso de una enzima ingeniería de Cdk1. Tiene un bolsillo de Unión más grande de sustrato y acepta versiones más voluminosas de ATP como sustrato6. Este sustrato voluminoso no se puede enlazar a quinasas de tipo salvaje. Extracto de la adición de ATP voluminoso radiactivo a una celda que contiene la enzima modificada de Cdk1, por tanto, permite el etiquetado específico de los sustratos directos de Cdk1. 200 Cdk1 objetivos fueron identificados en levadura de florecimiento con este método; sin embargo, no se puede aplicar a células de mamífero, que es una limitación fundamental. En otro estudio, Cdk1 sustratos fueron identificados en células de cultivo de tejidos humanos realizando análisis cuantitativo fosfoproteómico con dos inhibidores de molécula pequeña de Cdk1, Flavopiridol y RO-3306. 1215 fosfotoproteida en 551 proteínas se redujeron significativamente en Cdk1 inhibidor además7. Este método puede filtrar un proteoma completo de objetivos potenciales de Cdk1, pero resultando objetivos deban verificarse, por ejemplo, por una quinasa en vitro ensayo.

En el futuro, el análisis de la cinasa en vitro es probable que se combinarán con pantallas de alto rendimiento para sustratos de Cdk1 que están actualmente en desarrollo. Debido al gran número de sustratos de Cdk1 en el proteoma, muchos humanos Cdk1 sustratos permanecen para ser identificados, y el ensayo de quinasa en vitro será una herramienta importante para identificar, asignar y verificar estos sitios.

El ensayo de quinasa en vitro es una herramienta poderosa para identificar dianas para la quinasa Cdk1 y para identificar sitios de fosforilación específicos. Identificación de estos sitios de fosforilación permite estudio de mecanismos para la regulación de procesos celulares por Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Los autores no tienen nada que revelar.

Acknowledgments

Agradecemos a Dr. David Rey, Howard Hughes Medical Institute, Universidad de California en Berkeley para el análisis de espectrometría de masas y comentarios útiles. Agradecemos a Dr. Xuelian Zhu, Shanghai, institutos de ciencias biológicas, Academia de Ciencias de China, Shanghai, China para proporcionar una larga duración construcción de CENP-F. Finalmente, agradecemos al Dr. Susan Bane, Dr. Brian Callahan y Dr. Christof Grewer Universidad de Binghamton para acceso al equipo. Esta investigación fue financiada por la Fundación de investigación para la Universidad Estatal de Nueva York y el Departamento de química, Universidad Estatal de Nueva York en Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identificación de quinasa dependiente de ciclina 1 sitios específicos de fosforilación por una quinasa <em>In Vitro</em> ensayo
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter