Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Siklin bağımlı kinaz 1 tanımlaması belirli fosforilasyon siteleri bir Vitro kinaz tarafından tahlil

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Siklin bağımlı kinaz 1 (Cdk1) hücre döngüsünün G2 aşamasında aktif ve birçok hücresel yolları düzenler. Burada, bir vitro kinaz tahlil için bir protokol ile bu önemli kinaz hücresel hedefleri oluşturmak üzere Cdk1 özgü fosforilasyon siteler tanımlaması sağlar Cdk1 mevcut.

Abstract

Siklin bağımlı kinaz 1 (Cdk1) hücre döngüsünün bütün Ökaryotlarda bir ana denetleyicisidir ve Proteom yaklaşık 8-%13 phosphorylates; Ancak, özellikle insan hücrelerinde Cdk1 için belirlenen hedeflerin sayısı hala düşük. Nasıl Cdk1 hücre döngüsü kontrol içine mekanik anlayışlar sağladıkları gibi Cdk1 özgü fosforilasyon siteler tanımlanması önemlidir. Hücre döngüsü Yönetmeliği sadık kromozom ayrımı için önemlidir ve bu karmaşık bir süreç içinde kusurları kromozom anomalileri ve kanser neden.

Burada, biz Cdk1 özgü fosforilasyon siteleri tanımlamak için kullanılan bir vitro kinaz tahlil açıklayın. Bu tahlil fosforile vitro arıtılmış bir proteindir ticari olarak mevcut insan Cdk1/siklin B. başarılı tarafından fosforilasyon SDS-PAGE tarafından onaylandıktan ve fosforilasyon siteleri daha sonra kütle spektrometresi tarafından tanımlanır. Ayrıca son derece saf ve homojen protein kinaz tahlil ve bağlama tahlil için uygun hazırlıklar arasındaki etkileşimi probları tanımlanan fosforilasyon siteleri fonksiyonel doğrulanması için verim arıtma iletişim kurallarını açıklar bir klasik nükleer yerelleştirme sinyal (cNLS) ve onun nükleer taşıma reseptör karyopherin α. Deneysel tasarım ile yardımcı olmak için protein dizilerinden Cdk1 özgü fosforilasyon siteler tahmin için yaklaşımlar gözden geçirin. Birlikte bu protokollerin Cdk1 özgü fosforilasyon siteler verimleri ve mekanik çalışmaları nasıl Cdk1 hücre döngüsü kontrol eder içine sağlayan çok güçlü bir yaklaşım sunuyoruz. Bu yöntem üzerinde saf protein dayanıyor beri bu herhangi bir model organizma ve verimleri güvenilir sonuçlar için özellikle hücre fonksiyonel çalışmalar ile birlikte uygulanabilir.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinazlar fosfat grupları ATP yüzeyler transfer ve birçok hücresel süreçler düzenleyen enzimlerdir. Bu fosforilasyon geri alınabilir, hızlı, iki negatif ücretleri, ekler ve serbest enerji depolar ve hücreleri tarafından kullanılan en yaygın ardından değişiklikler biridir. Hücre bölünmesi döngüsü protein 2 homolog (cdc2) olarak da bilinen olan Cdk1 hücre döngüsünün bütün Ökaryotlar1,2,3,4,5ana bir denetleyicisidir ve phosphorylates bir yaklaşık 8-%13 Proteom6,7.

Bu değişiklikler için sorumlu kinaz bilinmeyen ise son proteomik çalışmalar proteinler, çoğu durumda, çok sayıda fosforilasyon site belirledik. Özellikle insan hücrelerinde bilinen Cdk1 hedeflerin sayısı düşük7var. Nasıl Cdk1 hücre döngüsü kontrol kurmak mekanik çalışmalar kullanmasına olanak tanır Cdk1 özgü fosforilasyon siteler tanımlanması önemlidir. Hücre döngüsü Yönetmeliği sadık kromozom segregasyon ve hücre bölünmesi için önemlidir ve hücresel sayısız bu önemli fizyolojik işlevi desteklemek için ortaya çıkması gereken. Bu transkripsiyon ve translasyon hücre yapısı ve organizasyon, nükleer zarf, kromozom yoğunlaşma ve Mitotik iğ Montaj Demontaj gibi dramatik bir yeniden yapılanma yanı sıra mitoz başlangıcı öncesinde durdurma içerir. Deregülasyon ve hataları bu süreçlerde kanser, doğum kusurları veya Mitotik hücre ölümüne neden olur. Cdk1 RO-3306 gibi belirli inhibitörleri fonksiyonel çalışmaları için güçlü araçlar sağlayan gelişmiş8, vardı ve bu inhibitörleri şu anda kanser tedavisi için klinik çalışmalarda bazı (9 inceleme için bakınız).

Burada, biz Cdk1 özgü fosforilasyon siteler tanımlaması sağlar bir vitro kinaz tahlil açıklayın. Bu tahlil, ticari olarak mevcut insan Cdk1/siklin B arıtılmış hedef protein vitrofazdan için kullanılır. Bir substrat fosforilasyon kütlesi artar ve iki negatif ücretleri ekler; Bu nedenle, başarılı fosforilasyon SDS-sayfa protein jel grubu yukarı doğru bir kayma tarafından onaylanır. Cdk1 özgü fosforilasyon siteleri daha sonra kütle spektrometresi fosforile vitro protein analizi tarafından tanımlanır. Deneysel tasarım ile yardımcı olmak için biz de Hesaplama araçları ve protein serisinden Cdk1 özgü fosforilasyon siteler tahmin için başvurular gözden geçirin. Ayrıca, aynı zamanda son derece saf ve homojen protein kinaz tahlil için uygun hazırlıklar verim arıtma iletişim kuralları açıklar. Son olarak, tanımlanan fosforilasyon siteleri fonksiyonel çalışmaları tarafından doğrulanması gerekir ve bir basit bağlama tahlil burada bu amaçla kullanılmıştır. Birlikte, bu Cdk1 özgü fosforilasyon siteler verimleri ve mekanik çalışmaları nasıl hücre döngüsü7,10,11Cdk1 denetler içine sağlayan çok güçlü bir yaklaşım olacaktır. Bu yöntem üzerinde saf protein dayanıyor beri herhangi bir model organizma ve verimleri güvenilir sonuçlar için uygulanabilir. Yerde, ardından değişiklikleri, etkileşim ortakları veya hücrede yerleşimi gibi ek düzenleyici mekanizmaları hücre var gibi Ancak, elde edilen fosforilasyon siteleri vitro işlevsel doğrulaması, tavsiye bu fosforilasyon siteleri erişilebilir veya Cdk1 tarafından tanınması için erişilebilir hale gelebilir.

Cdk1 (Ser/Thr-Pro-X-Lys/Arg), burada X herhangi bir kalıntı ve serin veya treonin fosforilasyonu sitedir oluşur bir fikir birliği fosforilasyon site tanır. + 1 pozisyon prolin varlığı tanıma için özellikle önemlidir. Buna ek olarak, temel kalıntıları + 2 veya 3 pozisyonlarda tercih edilmektedir, Lys veya Arg 3 içeren çoğu Cdk1 özgü fosforilasyon site ile6,12konum.

Cdk1 aktivasyonu sıkı bir şekilde düzenlenir ve mitoz1,2,3,4,5başlangıcı için yol açar. Siklin bağımlı kinaz aktivitesinin genel olarak onların dernek ile farklı siklinlere (siklin A, B, C, D ve E insanlarda), hücre döngüsü13boyunca düzeyleri salınan ifade edilir bağlıdır. Cdk1 ifade hücre döngüsü boyunca sabittir ve siklin A ve B5,13,14,15, olarak siklin düzenleyici alt birimleri ile dernek, düzenleme, faaliyete dayanan de translasyon modifikasyon. Cdk1/siklin B kompleks oluşumu kinaz harekete geçirmek5,14,15,16,17,18için gereklidir. G2 evresinde, siklin B sitozol tercüme ve nerede Cdk15,14,15,16,17,-18bağlar çekirdeği'a içe aktarılan; Ancak, B Cdk1/siklin fosforilasyon (membran ilişkili tirozin ve treonin özel cdc2 inhibitör kinaz) artıkları Thr14 ve Tyr15 insan Cdk1 inhibitör kinaz Myt1 tarafından ve Wee1, sırasıyla19tarafından Inaktif tutulur, 20,21. Geç G2 aşamasında, hücre bölünmesi döngüsü 25 fosfataz (cdc25) tarafından Thr14 ve Tyr15 dephosphorylation Cdk1/siklin B kompleks kinaz aktivitesinin etkinleştirir ve mitoz12,14, inisiyasyon tetikler 18 , 20 , 22 , 23. Thr161 fosforilasyon da Cdk1/siklin B harekete geçirmek için gereklidir ve Cdk7, Cdk aktive kinaz (CAK)18aracılık ettiği. Siklin B anafaz bozulma Cdk1, mitoz24,25dan çıkış sağlayan inaktive. B Cdk1/siklin aktivasyonu bu nedenle karmaşık bir süreçtir. Burada sunulan Protokolü piyasada bulunan Cdk1/siklin b ile gerçekleştirilir Böcek hücrelerinde rekombinant ifade bu kompleksin sırasında bu harekete geçirmek içinde vivo endojen kinaz14,20 ve arıtılmış durumda etkin kalır. Elde edilen aktif, rekombinant insan Cdk1/siklin B vitro kinaz deneyleri için uygundur.

Burada, biz Cdk1 özgü fosforilasyon siteler insan şeması protein F (CENP-F)10tanımlaması için bir iletişim kuralı tanımlamak. CENP-F, interfaz (G1 ve S-fazlı) en sırasında çekirdeğinde bulunan ve Cdk1 bağımlı bir şekilde10, G2 aşama26,27,28 sitozol verilir bir kinetochore protein 11. nükleer yerelleştirme önerebilirim cNLS26tarafından haiz. kolaylaştırır, birlikte karyopherin β ve RanGDP, cNLS-yük alma çekirdeği29içine nükleer taşıma faktörü karyopherin α cNLSs algılanır. G2 aşamasında nükleer verme yolu ile an bilinmeyen verme yolu10kolaylaştırılmıştır. CENP-F sitozol içinde bulunduğu nükleer zarf oluşturulmuştur ve sırayla motor protein kompleksi dinein30,31acemi. Bu yol için centrosome ilgili çekirdek Mitotik Milli Meclisi ilk aşamalarında Mitotik girdinin doğru zamanlama ve beyin temel bir işlemde önemlidir dinein bağımlı bir şekilde konumlandırmak önemlidir geliştirme30,31,32. G2 aşamasında başlayan, CENP-F de kinetochore sadık kromozom segregasyon27,28,33,34,35 için önemli roller bulunduğu monte edilir . Bir anahtar düzenleyici bu yollar CENP-F nükleer ihracat Cdk110,11tarihinde bağlıdır G2 aşamasında adımdır. Biz burada bir protokol Cdk1 özgü fosforilasyon siteler CENP-F. cNLS içinde tanımlanması için tarif Phosphomimetic mutasyonlar bu sitelerin CENP-F B Cdk1/siklin doğrudan CENP-F Hücrede yerleşimi onun cNLS10fosforilasyon tarafından düzenleyen düşündüren, nükleer alınmasıyla yavaşlatacak.

Kinaz Cdk1. saf hedef proteinler fosforile vitro piyasada bulunan Cdk1/siklin B kompleks ve fosforilasyon siteler için genel olarak, bu vitro kinaz tahlil belirli yüzeylerde tanımlaması sağlar daha sonra kütle spektrometresi tarafından tanımlanır. Cdk1 özgü fosforilasyon siteler tanımlaması nasıl Cdk1 hücre döngüsü kontrol ortaya mekanik çalışmaları destekler.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. tahmini Protein serisinden Cdk1 özgü fosforilasyon sitelerin

  1. Kinaz tahlil başlamadan önce tahmin edilen Cdk1 özgü fosforilasyon siteler için protein sırasını analiz ve bilinmeyen kinaz özgüllük ile edebiyat deneysel olarak kurulan fosforilasyon siteler için arama. Aşağıdaki araçlar, veritabanları ve özetlenen başvuruları kullanın.
    1. Üreticisinin 3.0 yazılım36,37 (http://gps.biocuckoo.org/online_full.php) Cdk1 özgü fosforilasyon siteleri hedef protein sırayla tahmin etmek için kullanın. Belgili tanımlık bağlantı burada ikincil yapısı ve yüzey erişilebilirlik ek açıklamalar içeren kapsamlı bir tahmin için kullanın.
    2. Yazılım, FASTA formatı protein sırayla girin. Kinaz özgüllük, kontrol serin/treonin kinaz, CMGC, CDK, CDC2, CDK1ve diğer özelliklerine işaretini kaldırın. Orta eşik olarak seçin ve Gönder düğmesini tıklatın.
    3. Cdk1 fikir birliği fosforilasyon sitesi (Ser/Thr-Pro-X-Lys/Arg) elde edilen tahmin edilen sitelerle karşılaştırın.
    4. Önemlisi, prolin fosforile kalıntı (bazı Cdk1 yüzeylerde en az site (Ser/Thr-Pro)6,12fosforile) yanındaki için öngörülen sitesini denetleyin. Ayrıca, + 2 veya 3 pozisyonlarda Lys veya Arg 3 pozisyon6,12içeren çoğu Cdk1 özgü fosforilasyon site ile tercih edilen temel artıkları, denetleyin.
  2. Ayrıca tam bir fikir birliği sitesi varlığı Cdk1 fosforilasyon için yeterli değil gibi site tanıma için erişilebilir olduğunu denetleyin.
    1. Yüzey erişilebilirlik ve ikincil yapı tahmini ek açıklama sitenin erişilebilir olduğu tahmin olup olmadığını bildiren üreticisinin çıktı incelemek; Esnek ve fosforilasyon için erişilebilir birçok durumda N - ve C-termini proteinlerin vardır.
    2. Hedef protein bir x-ışını yapısı varsa, erişilebilirlik sözde fosforilasyon sitelerin yapısını konumlarında inceleyerek kontrol edin.
  3. UniProtKB/İsviçre-Prot veritabanı38 (http://www.uniprot.org) kullanarak bilinmeyen kinaz özgüllük ile edebiyat deneysel olarak kurulan fosforilasyon siteler için arama.
    1. Protein adını arama kutusuna girin ve ara düğmesini tıklatın. Doğru sırada girişini seçin. Fosforilasyon siteleri açıklamalı ve amino asit değişiklikler bölümünde başvurulmuştur.
    2. Cdk1 hücre döngüsünün G2 aşamasında etkin hale gelir çünkü özellikle yararlı olan Mitotik özler insan hücre hatları7,39,40, proteomik çalışmaları için arama.
  4. NLSmapper (isteğe bağlı) tarafından önerebilirim cNLS tanımlayın.
    Not: sitozol ile çekirdek arasında mekik proteinler Cdk1 tarafından ana motif-1 konumundaki önerebilirim cNLS fosforilasyon Hücrede yerleşimi düzenlenmesi için ortak bir mekanizma var. Fosforilasyon G2 aşama10,41,42,43nükleer yerelleştirme onuntemsilcilerini yasakladı
    1. Mekik gibi proteinler, protein sırayla cNLS NLSmapper43 tarafından (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi) tanımlayın. Metin olarak protein sıra sıra kutusuna yapıştırın, kesme puanı 5.0 seçin ve tüm bölgeninNLS aramak için seçerler. NLS tahmin düğmesini tıklatın.
    2. Sonuç tahmin edilen cNLS X değil olumsuz ücret herhangi bir kalıntı nerede küçük motifi (Lys-Arg), en az 10 artıkları bağlayıcı ve ana motifi (Lys-Lys/Arg-X-Lys/Arg), oluşan bir önerebilirim cNLS fikir birliği dizisi karşı karşılaştırın .
    3. Tahmin edilen Cdk1 fosforilasyon site (*) bağlayıcı-1 konumundaki ana motifi bitişiğinde bulunan Eğer kontrol edin: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Not: Cdk1 tarafından-1 pozisyonda önerebilirim cNLS fosforilasyon birkaç mekik proteinler10,41,için42, Hücrede yerleşimi için düzenleyici bir mekanizma olarak kurulmuştur. 43.

2. ifade Escherichia Coli rekombinant proteinlerin

  1. Adımları 2.1.1-2.1.2 üzerinden ifade plazmid E. colirekombinant proteinlerin ifade kullanın.
    1. İnsan CENP-F (artıkları 2,987-3,065) ifade oluşturmakoluşturmak için ekler Polimeraz zincir tepkimesi (PCR) ile DNA parçalarının yükseltecek tarafından bir tam uzunlukta CENP-F yapı oluşturmak (GenBank katılım: U19769.1). Aşağıdaki astar kullanın: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG ve AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Not: Tam uzunlukta insan CENP-F plazmid cömertçe Dr X. Zhu, biyolojik bilimler, Çin Bilimler, Shanghai, Çin Akademisi için kurumları tarafından sağlandı.
      1. BamHI ve XhoI kısıtlama siteleri ile pGEX6p1 vektör içine ekleme klon. Bu plazmid N-terminal glutatyon S-transferaz (GST) füzyon protein CENP-f (artıkları 2,987-3,065) ifade etmek için kullanın.
        Not: GST-tag kapalı (bundan böyle PS proteaz da adlandırılır) PreScission proteaz tarafından i ciddi.
    2. İnsan karyopherin α ifade oluşturmakiçin bir tam uzunlukta karyopherin α2 cDNA şablondan PCR ile DNA parçalarının yükseltecek tarafından ekler oluşturur (sıra katılım NM_002264.3; astar: GCACTACATATGTCCACCAACGAGAATGCTAATA ve TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Not: izoformlarının benzerliği nedeniyle bu karyopherin α2 yapı, sonraki metni karyopherin α adlandırılır.
      1. NdeI ve XhoI kısıtlama siteleri ile pET28a-pres vektör içine ekleme klon.
        Not: Bu hangi sıra Trombin bölünme site için kodlama bir PS proteaz bölünme site için kodlar bir dizi yerine bir değiştirilmiş pET28a vektör olduğunu. Bu plazmid karyopherin α bir N-terminal ile bir füzyon protein onun6hızlı kullanmak-etiket, nerede onun6-etiket i ciddi kapalı PS proteaz tarafından.
  2. Nokta mutasyonlar hedef proteinoluşturmak için site yönettiği mutagenesis bir kit ile gerçekleştirin.
  3. E. coli olarak rekombinant proteinler sonraki arıtma için hızlı.
    1. Aşağıdaki hisse senedi olun: 50 mg/mL sefaloridin (1:1, 000 hisse senedi çözüm), 35 mg/mL kloramfenikol %70 etanol (1:1, 000), 100 mg/mL Ampisilin (1:1, 000) ve 1 M izopropil β-D-1-thiogalactopyranoside (IPTG; 1:5, 000).
    2. Steril hisse senetleri filtre ve -20 ° C'de depolayın Tekrarlanan donma-çözülme çevrimleri için IPTG kaçının.
    3. 1 µL ifade plazmid, üreticinin yönergelerine göre E. coli Rosetta 2 (DE3) pLysS gerginliği, yetkili hücrelerinin 50 µL dönüşümü.
    4. Luria-Bertani (LB) agar kloramfenikol (35 µg/mL LB) ile ve Ampisilin (100 µg/mL LB) CENP-F yapı, veya kloramfenikol ve sefaloridin (50 µg/mL kültür) karyopherin α inşa etmek için kültür plaka. Plakalar için 12-20 h 37 ° C'de kuluçkaya
    5. Bir koloni almak ve 50 mL lb (bkz. Adım 2.3.4) antibiyotik ile desteklenmiş aşılamak. 160-180 RPM için 12-20 h 37 ° C'de sallayarak süre preculture kuluçkaya
    6. 1 L hazırlamak LB orta 2.800 ml Fernbach şişesi şaşkın. Her preculture ve basınçlı kap için iki şişe yapmak onları. Havalandırma izin vermek için birden fazla üçte iki şişeye birimine şişeler doldurmayın. Erlenmeyer şişeler de kullanılabilir.
    7. Antibiyotikler (Adım 2.3.4) ve 10 mL soğutmalı LB. Ekle 20 mL preculture LB orta 1 litre başına 1 litre başına filtre steril % 40 (w/v) glukoz çözeltisi ekleyin.
      Not: 600 Absorbans nm 1:10 preculture seyreltme 0,15-0,2 arasında olmalıdır.
    8. 160-180 RPM 37 ° C'de sallayarak süre şişeler kuluçkaya 600 Absorbans ölçmek nm bakteri kültürü düzenli olarak. Absorbans 0,5-0,6 ulaşırsa, protein ifade 0.2 mM IPTG ekleyerek teşvik (LB orta 1 litre başına 1 M stokunun 200 µL).
      Not: Bu hücreler doğru Absorbans indüklenir önemlidir. Genellikle bu sahne ulaşmak için 3-4 saat sürer.
    9. 37 ° C'de 3 h için sallayarak süre şişeler kuluçkaya Santrifüjü (15 dk, 4,100 x g, 4 ° C, swing-out rotor) tarafından hücreleri hasat. Süpernatant atmak. 20 mL GST-bağlama arabellek (CENP-F) veya onun6hücre granül resuspend-kültür 1 litre başına bağlama arabellek (karyopherin α). -80 ° C'de hücreler depolamak
      1. GST-bağlama arabellek (10 mM Tris pH 8.0 25 ° c, 150 mM NaCl, 1 mM dithiothreitol (DTT), 0,5 mM EDTA) hazırlamak ve onun6-önceden arabellek (10 mM Tris pH 8.0 25 ° c, 250 mM NaCl, 5 mM Imidazole pH 8.0, 5 mM β-mercaptoethanol (BME)) bağlama.

3. glutatyon-benzeşme Kromatografi ve jel filtrasyon rekombinant Protein saflaştırma

  1. Aşağıdaki hisse senedi olun: 1 M DTT (1:1, 0.2 µM gözenek boyutu ile filtre ve degassed 000 stok, steril); 250 mM phenylmethylsulfonyl florür (PMSF; dimethylsulfoxide 1:1,000 stok). -20 ° C'de mağaza Tekrarlanan donma-çözülme çevrimleri kaçının.
  2. Aşağıdaki arabellekleri yapmak ve onları 4 ° C'ye serin
    1. GST-bağlama arabellek 10 mM Tris pH 8.0 25 ° C'de, 150 mM NaCl, 1 mM DTT, 0,5 mM EDTA kullanarak hazırlayın.
    2. GST-elüsyon arabellek 50 mM Tris pH 8.0 25 ° c, 150 mM NaCl, 1 mM DTT arabellekte çözünmüş 10 mM indirgenmiş glutatyon (0,15 g/50 mL) kullanarak hazırlayın. Son arabellek pH 8.0 olduğundan emin olun ve aynı gün yapıldığını kullanın.
    3. Jel-filtrasyon arabellek 20 mM Tris pH 7.5 25 ° C'de, 60 mM NaCl, 2 mM DTT kullanarak hazırlayın. Steril bir şişe-ilk filtre (0.2 µM gözenek boyutu) arabellek filtre. Vakum (-6 PSI) 15 dakika altında karıştırma sırasında arabellek degas.
    4. DTT her şeyden arabellekleri için kullanım gününde ekleyin.
  3. CENP-F yapı içeren hücreleri Bölüm 2 çözülme. GST-bağlama arabellek ile 40 ml ses düzeyini ayarlayın. 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0,5 M hisse senedi çözüm, pH 8.0), eklemek 7 mg benzamidine hidroklorid (1 mM) ve 40 mg D/L metiyonin.
    Not: proteolitik bozulması azaltmak için tüm adımları 4 ° C'de soğuk bir odada tercihen aksi belirtilmedikçe gerçekleştirin. Tüm hücreleri, lysates ve saf protein kesirler buzda tut ve proteaz inhibitörleri ekleyin. Sistein ve metionin kalıntılarının oksidasyonu önlemek için deneme günü reductants DTT ve metionin gibi ekleyin. Proteolitik bozulması azaltmak için adım adım hızlı çalışın.
  4. Lyse bir sonicator hücrelerde izler. Bir cam kabı lysate ile doldurun ve bir buz su banyosu içinde bırakın. Kültür (1 dk 40 s, 100 W (% 50) çıkış/genlik, 10 s bakliyat ve 10 s dinlenme döngüleri ile) solüsyon içeren temizleyicide. 250 µM PMSF sonication sonra ekleyin. Daha şeffaf bakmalı ve artık yapışkan hücre lysate, inceleyin.
  5. Açık lysate 12.000-40,000 x g, 25 dk, 4 ° c centrifuging tarafından Yuvarlak alt santrifüj tüpleri ve bir sabit açılı rotor kullanın.
  6. Denge glutatyon özel 1:1 Bulamaç 2 mL tek kullanımlık Kromatografi sütun ekleyerek gerçekleştirin. Sonuç sütun bir birim 1 ml olacak. Sütun 25 mL ultrasaf su ve GST-bağlama arabellek 25 mL ile yıkayın.
  7. Bağlama aşağıdaki gibi yapın. Bir soğuk oda veya soğuk kutusunda çalışma, lysate granül üzerinden dikkatle boşaltmak. Lysate (0.2 µm gözenek boyutu) filtre ve takılı sütun dökün. Sütun kap ve yavaşça nutating 4 ° C'de 30 dk süre kuluçkaya
  8. Yıkama bir rafa koymak sütun, reçine ve yerleşmek aracılığıyla akış toplamak izin. Sütun iki kez GST-bağlama arabellek 25 mL ile yıkayın.
  9. Proteolitik bölünme tarafından elute.
    1. Sütun takın. GST-bağlama arabellek 400 µL ve (1000 U/mg, etkinlik ile 2 mg/mL stok ya laboratuarda saf veya satın; Tablo malzemelerigörmek) PS proteaz 250 µL ekleyin.
    2. Sütun kap ve yavaşça arabellekte reçine resuspend girdap. 16-20 h 4 ° C'de sütunlarını kuluçkaya O zaman GST-bağlama arabellek sütun gelen proteolytically cleaved CENP-F parçası elute 4 mL ekleyin.
  10. Glutatyon elüsyon
    1. Sütun takın, GST-elüsyon arabellek (4 sütun cilt) 4 mL ekleyin ve ilişkili GST-etiket elute 10 dakikadır kuluçkaya. Eluate toplamak. Sütunları yeniden kullanım önce üretici tarafından açıklandığı gibi yeniden.
  11. PS proteaz elüsyon kesir ve glutatyon elüsyon kısmı SDS-sayfa tarafından % 16 Akrilamid jeller üzerinde analiz. Elektroforez 25 V/cm 45 dk. leke Coomassie Mavitarafından jelleri gerçekleştirin. Glutatyon kesir cleaved GST etiketi içerecektir, ancak PS proteaz kesir arıtılmış CENP-F parçası içerir. Proteolitik bölünme etkinliğini değerlendirmek için jel bakarak kontrol edin.
  12. PS konsantre proteaz eluate 0.5 ml bir 3 kDa molekül ağırlığı kesme santrifüj filtre cihazları kullanarak ( Tablo malzemelerigörmek). Eluate filtre üst bölümünde ekleyin ve 4.100 x g, 4 ° C (swing-out rotor) örnek konsantre de 10-15 dk artışlarla santrifüj kapasitesi. Sonra her artış pipetting karıştırın.
  13. Bir uygun filtrasyon sütun jel bağlanmak ( Tablo malzemeleri satın alma bilgileri için bkz:) bir hızlı protein sıvı Kromatografi (FPLC) sistemi için ve jel filtrasyon arabellek 1 sütun hacmi ile equilibrate.
  14. Bir microcentrifuge (20 dk, 21,700 x g, 4 ° C) konsantre CENP-F parçasındaki santrifüj kapasitesi. Ekleme örnek sütun ve jel filtrasyon arabellek 1 sütun hacmi ile elute. 0.6 mL kesirleri toplamak.
    Not: Jel filtrasyon arabellek sonraki kinaz tahlil ile uyumluluk için optimize edilmiştir. Hedef protein bu arabellekte kararlı ise sınamak. Eğer istikrarlı değil, daha fazla Sodyum Klorür eklemeyi deneyin.
  15. Tepe kesirler SDS-sayfa (Adım 3.11) tarafından analiz. Saf CENP-F kesimleri içeren bölümleri tepe kesirler havuz. Saf CENP-F parçaları konsantre 3.3 mg/ml (Adım 3.12). SDS-sayfa (Adım 3.11) tarafından arıtılmış CENP-F parçaları analiz.
  16. Protein konsantrasyonu tayini
    1. Örnek 1: 100 ultrasaf su sulandırmak ve kuvars mikro-küvet içinde yerleştirin. Kayıt spectra bir Spektrofotometre 220-300 nm dalga boyu mesafeden.
      Not: Protein konsantrasyonu c (mg/mL) aşağıdaki denklemi elde edilir:
      Equation
  17. 50 µL aliquots saf protein 0,5 mL mikrotüpler ve flash-dondurma yapmak onları sıvı azot. Aliquots-80 ° C'de depolayın

4. Ni-NTA benzeşme Kromatografi tarafından rekombinant Protein saflaştırma

  1. Aşağıdaki arabellekleri yapmak ve 4 ° C'ye serin
    1. Hazırlamak onun6-bağlama arabellek 10 mM Tris pH 8.0 25 ° C'de, 250 mM NaCl, 5 mM Imidazole pH 8.0, 5 mM BME kullanarak. BME kullanım gününde tüm arabellekleri için ekleyin.
    2. Hazırlamak onun6-yıkama arabellek onun aynı şekilde6-bağlayıcı arabelleğe ama 20 mM Imidazole kullanarak.
    3. Hazırlamak onun6-elüsyon arabellek bağlama arabellek ama 150 mM Imidazole kullanarak aynı şekilde.
  2. Bölüm 2 karyopherin α içeren hücreleri çözülme oluşturmak ve 40 ml ile yaptığı ses seviyesini6 -bağlama arabellek. 5 mM BME, 0.250 mM PMSF, 7 mg benzamidine hidroklorid (1 mM) ve 40 mg D/L metiyonin ekleyin.
    1. Aşağıdaki varyasyonları ile 3.4-3,8 adımda anlatıldığı gibi devam: onun6kullanın-bağlama arabellek GST-bağlama arabellek için tüm adımları yerine. Nikel benzeşme 4 mL glutatyon özel yerine kullanın (bkz. Tablo reçetesi) 2 mL sütun hacmi olacak sütunu için jel.
      Not: Nikel benzeşme sütunları DTT ve EDTA ile uyumlu değildir. İmidazole konsantrasyon elüsyon arabellekte 250 mM ye çıkartılmış nikel benzeşme jel yerine Ni2 +- nitrilotriacetic asit (NTA) özel, kullanılamaz duruma gelirse ( Tablo malzemelerigörmek).
  3. Yıkama onun68 mL içeren sütunlar-yıkama arabellek.
  4. Elute karyopherin α ile onun612 mL-elüsyon tampon ve eluate SDS-sayfa (Adım 3.11) tarafından analiz.
  5. PS proteaz eklemek 250 µL (Adım 3,9) için eluate ve 16-20 h 4 ° C'de için kuluçkaya Bu arada, iki kez onun61 L karşı eluate diyaliz-2-20 h, diyaliz membran bir 6-8 kDa molekül ağırlığı ile kesme kullanarak için bağlama arabellek.
  6. Nikel benzeşme jel sütun üretici tarafından açıklandığı gibi yeniden. Sütun ile onun625 mL equilibrate-bağlama arabellek. Diyaliz protein için sütun ekleyin ve 3.7 adımda anlatıldığı gibi bağlama adım gerçekleştirin.
  7. Saf karyopherin α içeren aracılığıyla akış toplamak, (onun ile6-etiket i ciddi kapalı) ve kalan protein ile onun6bir ek 4 mL elute-bağlama arabellek. Bu kesirler havuz. Onun612 mL sütunlarla elute-elüsyon arabellek. Bu kesir kirleri içerir.
  8. 4.4-4.5 adımlardan uncleaved ve i ciddi karyopherin α ve onun6verimliliğini değerlendirmek için SDS-sayfa (Adım 3.11) tarafından bu adım iki elüsyon kesirler analiz-tag bölünme ve saflık.
  9. Karyopherin α konsantre 8 mg/mL ve flash-donma sıvı azot (Adım 3.15-3.17).

5. Vitro kinaz tahlil Cdk1/siklin b

  1. Vitro kinaz tahlil
    Not: Kinaz varışta küçük aliquots yapmak, flash-onları sıvı azot donma ve onları-80 ° C'de depolayın 6 ay içinde kullanın. Moleküler ağırlık Cdk1 için 34 kDa ve siklin B'nin 48 kDa, siklin B SDS-sayfa üzerinde belirgin molekül ağırlığı yaklaşık 60 kDa iken.
    1. PK (kinaz ile sağlanan) arabelleği kullanarak x 10 hazırlamak 0,5 M Tris-HCl, 0.1 M MgCl2, 1 mM EDTA, 20 mM DTT, %0.1 Brij 35, pH 7.5 25 ° C'de
    2. 10 x ATP hisse senedi hazırlamak: 1 PK arabellek x 4 mm ATP bir çözüm olun ve hisse senedi son pH kontrol edin. Küçük aliquots-20 ° C'de depolayın ve donma-çözülme çevrimleri kaçının.
    3. CENP-f Mix 40 µL parçası (bir konsantrasyonu 3.3 mg/mL veya 400 µM), 6 µL 10 x PK arabellek, 3 µL ultrasaf su, 6 µL ATP 10 x hisse senedi ve 5 µL insan Cdk1/siklin B (1 µg, 100 U) 0.5 mL microtube içinde.
      Not: CENP-F parçası 8.6 kDa ve dört Cdk1 özgü fosforilasyon siteler molar kütleye sahip. Yeni bir substrat için kinaz konsantrasyon tahlil molar konsantrasyonu protein ve fosforilasyon sitelerin sayısı göre ayarlayın. 20.000 U/mL, insan rekombinant Cdk1/siklin B stok etkinliği olduğunu ve özel faaliyetin 1.000.000 U / mg. 1 U, Cdk1/siklin B fosfat 1 pmol aktarmak Cdk1 peptid substrat PKTPKKAKKL-NH2 katalizler için gerekli miktarı olarak tanımlanır (50 µM) 30 ° C'de 1 dk içinde ( Tablo malzemelerigörmek).
    4. 1-16 h 30 ° C'de bir su banyosunda reaksiyonlar Cdk1/siklin B. Incubate bir denetim reaksiyon hazırlamak
  2. Kinaz tahlil tepki 2.5 µL analiz ve denetim tarafından SDS-sayfa (Adım 3.11), 2,5 µL % 16 Akrilamid ile bir jel kullanarak. Çözünürlüğünü artırmak için çalışma süresi uzatmak.
  3. 6 M guanidin hidroklorür çözüm eşit bir hacmi kalan kinaz tahlil reaksiyon (ve denetim) ekleyin. Son guanidin hidroklorür konsantrasyon-ecek var olmak 3 M. analiz bu örnekleri kütle spektrometresi fosforilasyon siteleri belirlemek veya örnekleri analiz için bir kütle spektrometresi tesise göndermek ve sonra () fonksiyonu doğrulama gerçekleştirmek için (Bölüm 6) Bölüm 7).
    Not: sonraki kütle spektrometresi analiz için tek tek siteleri fosforilasyon verimliliğini tercihen % 100 mümkün olduğu kadar yüksek, fosforilasyon siteler aksi eşlenemez çok önemlidir. Büyük ölçüde fosforilasyon verimliliği artırmak için daha büyük miktarlarda Cdk1/siklin B ekleyin ve 16 h kuluçka süresini artırmak. ATP konsantrasyonu da iki katına.
  4. Sorun giderme için CENP-F (artıkları 2,987-3,065) bir vitro kinaz testin pozitif bir denetim olarak gerçekleştirin. B Cdk1/siklin taze toplu halde yüksek faaliyetleri ile kullanın.

6. Cdk1 özgü fosforilasyon siteleri tarafından kütle spektrometresi tanımlaması

  1. Denatüre ve protein örnekleri desalt için PLRP300 sütun microbore ters faz sıvı Kromatografi gerçekleştirin.
  2. CENP-F parçadaki fosforilasyon sitelerin sayısı elde etmek için sağlam vitro fosforile CENP-F 84-mer electrospray iyonlaşma iyon kapanı kütle spektrometresi (ESI-ITMS)44,45tarafından analiz.
  3. CENP-F phosphoamino asit site konumunu değerlendirmek için CENP-F protein örnekleri in vitro tripsin digests hazırlamak fosforile. Tripsin digests damlalıklı ipuçları desalting ile desalt.
  4. CENP-F tryptic digests electrospray iyonlaşma Fourier dönüşümü iyon cyclotron rezonans kütle spektrometresi (ESI-FTICR MS)tarafından analiz. ESI-FTICR Kütle Spektrometre 169 µs bir birikimi zamanla çözümlemesi gerçekleştirin.
    Not: ESI-FTICR MS tarafından belirlenen kitleler doğruluğunu 0.005 amu içinde olduğunu. Fosforile her tür toplam protein miktarı ilgili oranını ölçmek için kitle spectra tepe yükseklikleri belirleyin.

7. işlevsel doğrulaması: Phosphomimetic mutasyonlar analitik boyutu dışlama Kromatografi tarafından Protein-protein etkileşimleri üzerinde etkileri test

Not: işlevsel doğrulaması tanımlanan Cdk1 özgü fosforilasyon siteler için aspartates ile tanımlanan fosforilasyon siteleri değiştirerek phosphomimetic mutantlar, CENP-F parçacıkları oluşturulan . Aspartat negatif yük fosforilasyon etkilerini taklit eder. Bir S3048D mutant CENP-F parçasının (artıkları 2,987-3,065) oluşturuldu.

  1. İşlevsel doğrulaması için vahşi tipi bağlama karşılaştırın ve karyopherin α. phosphomimetic CENP-F parçaları bir analitik jel filtrasyon bağlama tahlil olarak kullanın. Analitik jel filtrasyon için CENP-F parçaları glutatyon benzeşme Kromatografi (adımları 3.1-3.12), tarafından arındırmak ve jel filtrasyon adımı atlayın.
  2. 5-6 mg/ml protein konsantre. Flaş-protein aliquots sıvı azot (Adım 3.15-3.17) donma.
  3. Mix arıtılmış CENP-F parçaları (0.1 mg, vahşi-türü veya S3048D varyant) ve saf karyopherin α (0.7 mg) 1:1 molar oranı. Jel filtrasyon arabelleği ile 200 µL için örnek ses düzeyini ayarlayın. Buz üzerinde 30 dk için örnek kuluçkaya, örnek (0.2 µm gözenek boyutu) filtre ve örnek Santrifüjü tarafından (25 dk, 21,700 x g, 4 ° C) temizleyin
  4. Örnek boyutu dışlama Kromatografi tarafından (Adım 3.13-3.14) ayırın. 20 mM HEPES, pH 7.5, 150 mM NaCl ve 2 mM DTT oluşan bir jel filtrasyon arabellek kullanın. Analitik jel filtrasyon deneyler tüm örnekleri için aynı koşullar altında gerçekleştirmek.
  5. Analitik jel filtrasyon sütun bilinen molar kütle molekül ağırlığı standartlara üretici tarafından açıklandığı gibi ayarlayın.
  6. Elüsyon kesirler 16 oranında analiz SDS-sayfa (Adım 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Son zamanlarda bir cNLS10bulunan bir CENP-F parçadaki Cdk1 özgü fosforilasyon siteleri tanımlamak için bir vitro kinaz tahlil (şekil 1) kullandık. Bu sinyal CENP-F nükleer yerelleştirme Interphase lerin confers. G2 evresinde, CENP-F sitozol Cdk1 bağlı şekilde çekirdek verilir. Nasıl CENP-f Hücrede yerleşimi Cdk1 düzenleyen üzerinde mekanik anlayışlar elde etmek için biz üreticisinin sunucu36,37kullanılarak Cdk1 özgü fosforilasyon siteler, tahmin etmek için CENP-F dizisini analiz. CENP-F cNLS içinde üç Cdk1 özgü fosforilasyon siteleri artıkları 3,042, 3045, tahmin ve 3,048 (Tablo 1). Başka bir Cdk1 özgü fosforilasyon site ayrıca kalıntı 3,007 (Tablo 1)10için tahmin edilmiştir. Bu nedenle, biz Cdk1 doğrudan onun cNLS fosforilasyon tarafından CENP-F yerelleştirme düzenleyen onaylanmadığına karar.

% 16 olup CENP-F cNLS bir substrat Cdk1 için biz bir vitro kinaz tahlil arıtılmış insan CENP-F parçası (artıkları 2,987-3,065) ile gerçekleştirilen ve Cdk1/siklin insan B. vitro fosforile CENP-F test etmek için analiz edildi SDS-sayfa, kinaz Cdk1 yoksun bir negatif kontrol ile birlikte (şekil 2A)10. Vitro CENP-F fosforile için açık yukarıya doğru bir kayma için negatif denetimine göre jel bandında görülmektedir. İki negatif ücretleri ve ek kitle her fosfat grubu ekler olarak bu fosforile proteinlerin normaldir. Bu sonuç CENP-F Cdk1/siklin B10tarafından fosforile öneririz.

CENP-F fosforilasyon sitesi sayısını belirledikten ve bu siteler fosforilasyon verimliliğini ölçmek için sağlam vitro fosforile CENP-F parçası (84-mer) kütle spektrometresi (ESI-ITMS)10tarafından analiz edildi. Gözlenen ESI-iyon kapanı (şekil 2B) spektrum kitle sağlam CENP-F parçası dört site (Tablo 1)10, fosforile öneriyor.

CENP-F dizisi fosforile amino asit Siteler'de konumunu tarafından değerlendirildi lysines ve arginines sonra cleaves protein zincirleri tryptic digests ESI-FTICR Bayan tripsin tarafından incelenmesi ve CENP-F parçası bir tripsin özünü içinde birkaç sonuçlandı peptidler, 3,031-3, 052 artıkları bulunan da dahil olmak üzere. Bu CENP-F peptid kitle spectra fosforilasyon, T3042, T3045 ve S3048, cNLS (Tablo 1)10içinde bulunan artıkları ile tutarlı edildi. Başka bir tryptic peptid (artıkları 2.995-3,016) kitle spectra fosforilasyon, S3007 ile tutarlı (Tablo 1)10. Tüm dört Cdk1 özgü fosforilasyon siteler de serisinden tahmin. Cdk1 özel yüzeylerde genellikle artıkları T3042, T3045 ve S3007 gibi bir prolin fosforile6, kalıntı yanındaki içerir. Bir fenilalanin serin yanında yer alır gibi S3048 biraz alışılmadık bir Cdk1 özgü fosforilasyon site olduğunu belirtmek gerekir. Sonuç olarak, CENP-F özellikle kinaz Cdk1 artıkları 3.007, 3,042, 3.045 ve 3,048 fosforile sonuçları öneririz. Bu üçünü CENP-F (Tablo 1), Cdk1 CENP-F Hücrede yerleşimi cNLS fosforilasyon Cdk1 aktif10olduğu G2 aşamasında aracılığıyla düzenleyen gösteren cNLS içinde yer almaktadır.

Bu Cdk1 özgü fosforilasyon siteler fizyolojik işlevi yüklü olduğunu doğrulamak için phosphomimetic değişken S3048D10oluşturdu. Phosphomimetic mutasyonlar tarafından olumsuz tahsil artıkları fosforilasyon etkilerini taklit. Daha sonra phosphomimetic sürüm cNLS bulunan CENP-F parça saf. CENP-F cNLS yüksek afinite ile bağlanır ve CENP-F. nükleer alma için gerekli olan nükleer taşıma reseptör karyopherin α tarafından tanınan Phosphomimetic mutasyon CENP-F cNLS onun nükleer taşıma reseptör karyopherin α ile arasındaki etkileşim zayıflar olup olmadığını sınamak için bir bağlama tahlil (şekil 3)10gerçekleştirilen. Bu deneylerin bir saf CENP-F parçası (vahşi türü veya S3048D varyant) saf insan karyopherin α ile karışık oldu ve karışım analitik boyutu dışlama Kromatografi tarafından ayrılmış. Buna ek olarak, proteinler de ayrı ayrı analiz edildi. SDS-sayfa analizi elüsyon kesirler her iki proteinler Co (şekil 3)10elute beri vahşi tipi CENP-F parçası cNLS ile güçlü karyopherin α ile etkileşim ortaya koydu. Ancak, yalnızca önemsiz miktarda CENP-F S3048D parçası karyopherin α bağlar ve bu proteinler ayrı ayrı (şekil 3)10elute. Bu sonuçlar fosforilasyon öneririz kalıntısı CENP-F cNLS 3,048 nükleer taşıma faktörü karyopherin α ile etkileşim üzerinde güçlü bir etkisi olurdu. Bu nükleer alma oranları son derece doğru bir nükleer taşıma faktör46nükleer yerelleştirme sinyal benzeşme hakkında bağımlıdır ve bu nedenle, bu mutasyonlar nükleer alma10yavaş bekleniyor olması gerekmektedir.

Figure 1
Şekil 1: Cdk1 vitro kinaz testin şematik gösterim. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 2
Resim 2: CENP-F Cdk1/siklin b tarafından fosforile (Belirli fosforilasyon siteleri, vitro kinaz tahlil gerçekleştirilen Cdk1 arıtılmış CENP-F (artıkları 2,987-3,065) ile tanımlamak içinA). SDS-sayfa analizi olmadan Cdk1/siklin B negatif bir denetimin sol şeritte gösterilir (-Cdk1), yanında vitro fosforile CENP-F sağ lane (+ Cdk1). Moleküler ağırlık standartlar belirtilmiştir. Fosforile CENP-F yukarı doğru kayması SDS-sayfasında, hangi başarılı fosforilasyon ile tutarlı olduğunu unutmayın. Cdk1 ve siklin B 34 kDa ve 60 kDa zayıf grupları olarak görünür. (B) ESI-iyon tuzak kütle spektrometresi sağlam fosforile CENP f (a) sağlam fosforile CENP-F (84-mer) fosfat yükünü belirlemek için kullanılır. Karşılık gelen kitle spektrum gösterilir. Yoğunluğu kitle ücret oranı (m/z) karşı çizilir. Spektrum + 10 + 14 ücret Devletlere sağlam CENP-F parçasının fosforilasyon sonra gösterir. Bunlar bir tür nüfus ile 0, 1, 2, 3 ve 4 fosfat esterleri gösterir. Her tür toplam protein miktarı için oranını ölçmek için tepe yükseklikleri belirlenmiştir ve (Tablo 1) göre. Bu rakam10 ' dan değiştirildi ve izni ile Taylor ve Francis yayımcı tarafından çoğaltılamaz. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 3
Şekil 3: fonksiyonel doğrulama: CENP-F phosphomimetic mutasyonlar güçlü nükleer taşıma reseptör karyopherin α ile etkileşimi azaltmak. (A-F) Saf CENP-F parçaları (artıkları 2,987-3,065) (0.1 mg) ve saf karyopherin α (0.7 mg) 1:1 molar oranı karışık ve boyutu dışlama Kromatografi tarafından analiz. CENP-F parçaları ve karyopherin α da ayrı ayrı analiz edildi. Tepe kesirler SDS-sayfa analizi gösterilir. Elüsyon birimleri (0.6 mL artışlarla) altta gösterilir. Sol tarafta, molekül ağırlığı marker grup ve onların kitleler pozisyonlarda kDa gösterilir. Bir yıldız işareti kalan GST (glutatyon S-transferaz) izleri işaretler. (A)Karyopherin α. (B) elüsyon profilleri. 280 Absorbans nm elüsyon birimin karşı çizilir. Karyopherin α (kırmızı) elüsyon profil karyopherin α CENP-F parçaları ile karışımları elüsyon profilleri ile overlaid (vahşi-türü: yeşil; phosphomimetic S3048D mutant: mavi). Ayrıca vahşi tipi CENP-F parçasının CENP-F vahşi tipi parçasının bağlama ile tutarlı yüksek ayine karyopherin α tepe elüsyon hacmi vardiya unutmayın. Bu değişim değil görülmektedir phosphomimetic mutasyon karyopherin α. (C) CENP-F vahşi tipi parçası (wt) CENP-F Etkileşim büyük ölçüde azalır düşündüren phosphomimetic mutasyon S3048D ile CENP-F parçası eklenir ve karyopherin α. (D) CENP-F wt parçası. (E) CENP-F S3048D parça ve karyopherin α. (F) CENP-F S3048D parçası. Bu rakam10veri ile oluşturuldu. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Tablo 1A. Sıra ile (artıkları 2987-3065) CENP-F parçasının Cdk1 özgü fosforilasyon siteler daha büyük yazı tipi boyutu tarafından vurgulanan öngördü. Tryptic parçaları kalın olarak vurgulanmış ve altı çizili.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tablo 1B. Kütle spektrometresi analizleri sağlam CENP-F
vitro fosforilasyon Cdk1/siklin b sonra 84 mer
# tespit fosforilasyon siteleri (P) Toplam protein % ifade edilen fosfat yük
CENP-F 2987-3065 0P % 6
1 P % 37
2P % 40
3P % 15
4P % 3
Tablo 1C. CENP-F tryptic peptidler vitro fosforilasyon Cdk1/siklin b sonra kütle spektrometresi analizleri
# fosforilasyon siteleri Fosfat yük
Tryptic phosphopeptide, 0P % 57
artıkları 2995 3016 1 P % 43
Tryptic phosphopeptide, 0P % 7
artıkları 3031-3052 1 P %64
2P % 29
3P % 1

Tablo 1: Kütle spektrometresi analiz CENP-F parçasının vitro fosforilasyon Cdk1/siklin B. ile sonra Bu tablo veri10ile oluşturuldu.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Bizim vitro kinaz tahlil hangi hücre döngüsünün ana denetleyicisi ve birçok önemli hücresel süreçler düzenleyen kinaz Cdk1, moleküler hedefleri tanımlamak için çok güçlü bir yöntem olduğunu. Yöntem bir saf protein bir substrat Cdk1 için ve belirli fosforilasyon sitelerin kimlik sağlar Eğer belirler. Bu Cdk1 aracılığıyla fosforilasyon tarafından mekanik çalışmaları, düzenleme, hücresel süreçler için kolaylaştırır.

En kritik kütle spektrometresi fosforilasyon siteleri başarılı tanımlanması için kinaz tahlil fosforilasyon verimliliğini faktördür. Tek tek siteleri fosforilasyon verimliliğini tercihen % 100 mümkün olduğu kadar yüksek olmalıdır. Bu Cdk1/siklin B miktarını artırarak ve artan yaşam kuluçka süresi 16 h tarafından sağlanabilir. Ne zaman B Cdk1/siklin miktarını hesaplamak gerekli protein ve fosforilasyon siteleri düşünülmesi gereken sayıda molar konsantrasyon. Hedef protein fosforilasyon birden varsa, bu özellikle önemlidir. Bu da ticari Cdk1/siklin B etkinlik toplu iş toplu değişebilir ve kinaz aktivitesi hızla kaybedebilir unutulmamalıdır. Vitro fosforilasyon başarısız olursa, bu kinaz aktivitesinin test etmek için tavsiye edilir. Sorun giderme için pozitif kontrol CENP-F (artıkları 2,987-3,065) in vitro fosforilasyon kullanılabilir. Bir negatif kontrol Cdk1/siklin B ek bir reaksiyon gerçekleştirilen ve analiz. Başka bir yararlı negatif kontrol nedeniyle bir basit nokta mutasyon (D146N)47,48,49catalytically etkin değil Cdk1 bir kinaz-ölü mutant kullanmaktır. Buna ek olarak, belirlenen fosforilasyon siteleri doğrulamak için hedef protein phosphonegative sürümü, nerede fosforilasyon siteleri alanines tarafından değiştirilir oluşturulabilir. Tanımlanan fosforilasyon siteleri doğru ise, karşılık gelen phosphonegative mutant fosforile içinde vitroolamaz.

Hedef protein başarılı fosforilasyon algılamak için basit bir araç burada açıklanan basit SDS-sayfa jel üst karakter tahlil olduğunu. Fosforile proteinlerin genellikle daha yavaş SDS-sayfasında eklenen boyut ve negatif ücretleri nedeniyle unphosphorylated meslektaşlarına geçirin. Not büyük proteinler için yeterince jel shift görselleştirmek için çözünürlüğünü artırmak için en iyi duruma getirme SDS-sayfa analizi gereklidir. Yararlı bir araç için fosforile proteinlerin belirli ayrılık fosfat bağlayıcı etiketi (Phos-etiket) SDS-sayfa. Karşılık gelen ile karşılaştırıldığında daha yavaş geçirme bantları proteinler50,51dephosphorylated gibi Phos etiketi Akrilamid ile hazırlanan bir jel fosforile proteinlerin görüntülenir.

Yüksek kaliteli kitle spectra elde etmek için vitro kinaz tahlil için protein saf ve homojen çok önemli. Bizim arıtma protokolü bu birkaç çok seçici Kromatografi adım birleştiren ve protein yıkımı ve oksidasyon, proteaz inhibitörleri ve reductants aracılığıyla erişir. Glutatyon (Yani, etiketiyle GST-sağlam); arıtma Protokolü protein elute için değiştirilebilir Ancak, başka bir 25 kDa GST-etiketi ekler ve büyük proteinler hedefler için kütle spektrometresi zorlu düşünülmelidir. Alternatif olarak, bizim arıtma protokolü için onun6-etiket füzyon protein-ebilmek da var olmak kullanılmış.

Bu iletişim kuralı için diğer kinaz özgü fosforilasyon siteleri tanımlamak için de değiştirilebilir. Tek şart, saflaştırılmış kinaz kullanılabilir, etkin ve yeterince istikrarlı olmasıdır. Tahlil koşulları her kinaz maksimum etkinlik elde etmek ayarlanması gerekir. En iyi duruma getirmek için parametreleri kinaz, reaksiyon arabellek (pH, tuz konsantrasyonu), kuluçka süresi, reaksiyon sıcaklık ve ATP konsantrasyon miktarı içerir. Vitro kinaz deneyleri başarılı bir şekilde birçok Plks (polo gibi kinaz)52,53,54dahil olmak üzere kinaz ve MAPK/ERK kinaz (mitojenle-aktive protein fosforilasyon siteleri tanımlamak için kullanılan kinazlar / hücre dışı sinyal düzenlenir kinaz)55,56.

Bu yöntemin gücü saf protein belirli fosforilasyon siteleri tanımlamak için olsa da, bir hedef için Cdk1 içinde in vitro bir fosforilasyon site mutlaka fosforile içinde vivoolmayabilir unutulmamalıdır. Vivo, bir fosforilasyon siteyi Cdk1 tarafından tanınması için ulaşılmaz görüntülemek yerde ek düzenleyici mekanizmaları vardır. Örneğin, ek etkileşim Ortaklar ya fosforilasyon sitesi gizlemek veya yapısal değişiklikler üzerinden erişilebilir hale getirme ihtimali mevcut vivo içindeolabilir. Bundan başka belgili tanımlık substrate Cdk1/siklin B çekirdek ile G2 aşamasında fosforile için colocalize gerekiyor. Buna ek olarak, translasyonel modifikasyonlar veya diğer düzenleyici işlemlerin hangi fosforilasyon siteyi ulaşılmaz görüntülemek hedef protein vivo içindebiçimi etkileyebilir. Hücreleri veya tanımlanan fosforilasyon siteleri fizyolojik bir işlevi olduğunu doğrulayın hayvan modelleri uygun deney tasarlayarak bu sınırlamalar üstesinden gelebilir. Burada, biz bir basit bağlama tahlil için işlevsel doğrulaması'nı, fosforilasyon azalır CENP-F karyopherin α. işlevsel doğrulaması ile etkileşimi de hücre bağlamında veya bir hayvan modeli içinde gerçekleştirilmesi gerekiyor. Bu nedenle, biz de floresan füzyon protein parçalarının CENP-F-cNLS HeLa hücreleri10bulunan transfected. CENP-F cNLS içinde Phosphomimetic mutasyonlar bu fosforilasyon siteleri10bir fizyolojik fonksiyonu doğruladı nükleer yerelleştirme azalmış.

Çeşitli araçlar hücreleri veya hayvan modelleri fosforilasyon sitelerin fonksiyonel doğrulama için kullanılabilir. Fosforilasyon etkileri olumsuz ücretleri ile taklit, Phosphomimetic mutasyonlar bu amaç için yaygın olarak kullanılır. Bunlar için aspartat veya Glutamat fosforilasyon sitesi (serin veya treonin) yerini alır. Sadece bir nokta mutasyon hedef protein gereklidir avantajdır. Bunu belirtmek, phosphomimetic mutasyonlar başarıyla birçok durumda fonksiyonel doğrulama için kullanılan iken, özellikle durumlarda ücret değişiklikleri yönetmelik yerine yapısal bir değişim için baskın katılımcı nerede çalıştıklarını. Phosphomimetic mutasyonlar fosforilasyon diğer birçok durumda (örneğin, 11) etkilerini taklit etmek başarısız. Ancak, diğer yaklaşımlar fosforilasyon siteleri phosphonegative mutasyonlar kullanımı da dahil olmak üzere, işlevsel doğrulaması için kullanılabilir: alanin ile fosforilasyon siteleri değiştirerek bu mutasyonlar fosforilasyon önlemek. Hücresel bağlamda işlevsel doğrulaması için başka bir yararlı yaklaşım kinaz-ölü mutant bir nokta mutasyon (D146N) kolay tanıtmak47,48,49tarafından inaktive Cdk1 bir ifadesidir. Özellikle, birkaç küçük molekül Cdk1 inhibitörleri ticari Flavopiridol ve fonksiyonel çalışmalar hücreleri veya hayvan modelleri7,8,11için kullanılan RO-3306 gibi mevcuttur. Bu inhibitörleri iyi karakterize, ve birkaç (için bir daha gözden geçirme bkz:9) kanser tedavisi için klinik çalışmalarda vardır.

Protein fosforilasyon siteleri çok sayıda proteomik çalışmalarda tespit edilen süre kinaz özgüllük çoğu durumda bilinmeyen, ve vitro kinaz tahlil kaç yöntemlerinden Cdk1 yüzeylerde tanımlamak kullanılabilir. Diğer yaklaşımlar da kullanılmıştır. Cdk1 hedefleri mühendislik Cdk1 enzim kullanarak tespit edilmiştir. Bu daha büyük bir substrat bağlama cep ve daha hantal bir substrat6ATP sürümleri kabul eder. Bu hantal substrat vahşi tipi kinaz için bağlanamıyor. Bir hücreye radiolabeled hantal ATP ilavesi ayıklamak değiştirilmiş Cdk1 enzim bu nedenle yol açar ve Cdk1. yüzeylerde doğrudan belirli etiketleme için içeren 200 Cdk1 hedefleri bu yöntemle; mayası içinde tespit edildi Ancak, bu memeli hücreleri için hangi önemli bir kısıtlamadır uygulanamaz. Başka bir çalışmada, iki küçük molekül inhibitörleri Cdk1, Flavopiridol ve RO-3306 nicel phosphoproteomics analizi gerçekleştirerek insan doku kültürü hücrelerde Cdk1 yüzeylerde tespit edilmiştir. 1215 phosphopeptides 551 proteinler üzerinde Cdk1 inhibitörü ek7önemli ölçüde azaltıldı. Bu yöntem tüm Proteom potansiyel Cdk1 hedefleri için ekran edebilirsin ama hedefleri doğrulanması gerek kaynaklanan, örneğin, bir vitro kinaz tarafından tahlil.

Gelecekte, vitro kinaz tahlil büyük olasılıkla halen geliştirme aşamasında olan Cdk1 yüzeyler için yüksek işlem hacmi ekranı ile birleştirilebilir. Proteom Cdk1 yüzeylerde çok sayıda, nedeniyle tespit edilmesi birçok insan Cdk1 yüzeylerde kalır ve vitro kinaz tahlil belirlemek, harita ve bu siteler doğrulamak için önemli bir araç olacak.

Vitro kinaz tahlil kinaz Cdk1 için hedefler belirlemek ve belirli fosforilasyon siteleri tanımlamak için güçlü bir araçtır. Bu fosforilasyon sitelerin kimlik hücresel işlemler Cdk1 tarafından düzenlenmesi için mekanik çalışmaları sağlar.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Yazarlar ifşa gerek yok.

Acknowledgments

Biz Dr David King, Howard Hughes tıp Enstitüsü, University of California Berkeley kütle spektrometresi analiz ve yararlı yorumlar için teşekkür ederiz. Biz Dr Xuelian Zhu, Shanghai, Biyoloji Bilimleri enstitüleri, Çin Bilimler Akademisi, tam uzunlukta bir CENP-F yapı sağlamak için Shanghai, Çin teşekkür ederim. Son olarak, biz Dr Susan Bane, Dr Brian Callahan ve Dr Christof Grewer Binghamton Üniversitesi'nde ekipmana için teşekkür ederim. Bu araştırma State University of New York ve State University of New York Binghamton, Kimya bölümü için Araştırma Vakfı tarafından finanse edildi.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Siklin bağımlı kinaz 1 tanımlaması belirli fosforilasyon siteleri bir <em>Vitro</em> kinaz tarafından tahlil
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter