Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

 종속 키 1의 시험관에서 키에 의해 인 산화 특정 사이트 분석 결과

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

 종속 키 1 (Cdk1) 세포 주기의 g 2 단계에서 활성화 되 고 많은 세포 경로 조절. 여기, Cdk1, Cdk1-특정 한 인 산화 위치의 식별이 중요 한 키의 셀룰러 목표 설정에 대 한 수와 함께 체 외에 니 분석 결과 대 한 프로토콜 선물이.

Abstract

 종속 키 1 (Cdk1)는 모든 진핵생물의 세포 주기 위한 마스터 컨트롤러와 프로테옴;의 약된 8-13% phosphorylates 그러나, Cdk1, 특히 인간의 세포에에서 대 한 확인된 대상 수 여전히 낮습니다. Cdk1-특정 한 인 산화 위치의 식별 중요 하다, 그들은 Cdk1 세포 주기를 제어 하는 방법에 대 한 기계적 통찰력을 제공. 세포 주기 규칙 충실 한 염색체 분리에 대 한 중요 하 고이 복잡 한 과정에 결함 염색체 착오 및 암으로 이어질.

여기, 우리가 시험관에서 키 분석 결과 Cdk1 관련 인 산화 위치를 식별 하는 데 사용 되는 설명 합니다. 이 분석 결과, 순화 된 단백질은 phosphorylated 생체 외에서 상용 인간 Cdk1/ B. 성공에 의해 인 산화 SDS 페이지에서 확인 및 인 산화 사이트 이후 질량 분석에 의해 식별 됩니다. 우리는 또한 정화 프로토콜 간의 상호 작용을 조사 확인 된 인 산화 위치의 기능 검증에 대 한 키 니 아 제 분석 실험 및 바인딩 분석 결과 대 한 적합 한 매우 순수 하 고 균질 단백질 준비 항복을 설명합니다 클래식 핵 지 방화 신호 (cNLS) 그리고 그것의 핵 수송 수용 체 karyopherin α. 실험 설계와 투입, 단백질 시퀀스에서 Cdk1 관련 인 산화 위치의 예측에 대 한 접근 방법을 검토 합니다. 함께 이러한 프로토콜 Cdk1 전용 인 산화 사이트를 생성 하 고 Cdk1 세포 주기를 제어 하는 방법으로 기계 론 적인 연구는 매우 강력한 접근 방식을 제공 합니다. 때문에이 메서드는 순화 된 단백질에 의존, 그것은 적용할 수 있습니다 어떤 모델 유기 체 및 수율 신뢰할 수 있는 결과에, 세포 기능 연구와 결합 하는 경우에 특히.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinases는 기판에 ATP에서 인산 염 그룹을 전송 하 고 많은 세포질 과정을 조절 하는 효소. 이 인 산화 되돌릴 수, 빠르고, 두 부정적인 요금을 추가 및 저장 자유 에너지, 하 고 셀에서 사용 하는 가장 일반적인 posttranslational 수정 중 하나입니다. Cdk1, 일컬어 세포 주기 단백질 2 체 (cdc2)는 모든 진핵생물1,2,3,,45, 세포 주기 위해 마스터 컨트롤러가 고 phosphorylates는 프로테옴6,7의 예상된 8-13%.

최근 proteomic 연구는 단백질, 대부분의 경우에서에 많은 인 산화 사이트를 확인 하는 동안 키 이러한 수정에 대 한 책임을 알 수 있다. 인간 세포에서 특히 알려진된 Cdk1 목표의 수는 낮은7. Cdk1-특정 한 인 산화 위치의 식별 Cdk1 세포 주기를 제어 하는 방법을 설정 하는 기계 론 적인 연구를 하면 그것은 중요 하다. 세포 주기 규칙은 충실 한 염색체 분리 및 세포 분열에 대 한 중요 한 그리고 세포질 과정의 무수 한이 중요 한 생리 기능을 지원 하기 위해 발생 해야 합니다. 전사와 유사 분열, 세포의 구조와 핵, 염색체 응축, mitotic 스핀 들 어셈블리의 분해 등의 조직에 극적인 개편의 발병 이전 번역 중단 포함 됩니다. 규제 완화와 이러한 프로세스에서 오류가 발생할 암, 출생 결함, 또는 mitotic 세포 죽음. RO-3306 같은 Cdk1의 특정 억제제 개발된8, 기능성 연구를 위한 강력한 도구를 제공 하는 되었고 이러한 억제제 중 일부는 현재 암 치료에 대 한 임상 시험 (검토를 위해9 참조).

여기, 우리가 시험관에서 키 분석 결과 Cdk1 관련 인 산화 위치의 식별 수 있도록 설명 합니다. 이 분석 결과에서 상용 인간 Cdk1/ B는 순화 대상 단백질에서 생체 외에서phosphorylate 데 사용 됩니다. 기판의 인 산화의 질량을 증가 하 고 추가 두 음 전; 따라서, 성공적인 인 산화는 SDS 페이지에 단백질 젤 밴드의 상승 교대에 의해 확인 된다. 인 산화 Cdk1 특정 사이트 이후 체 외에 phosphorylated 단백질의 질량 분석 분석에 의해 식별 됩니다. 실험적인 디자인으로 돕기 위해 우리는 또한 계산 도구와 단백질 시퀀스에서 Cdk1 관련 인 산화 위치의 예측에 대 한 참조를 검토 합니다. 또한, 우리는 또한 매우 순수 하 고 균질 단백질 준비 니 분석 결과 대 한 적합 한 생성 하는 정화 프로토콜 설명 합니다. 마지막으로, 기능 연구에 의해 확인 된 인 산화 사이트를 확인 해야 합니다 그리고 여기에 설명 된 간단한 바인딩 분석 결과 그 목적을 위해. 결합, 이것은 매우 강력한 접근 Cdk1 세포 주기7,,1011를 제어 하는 방법으로 기계 론 적인 연구를 가능 하 게 Cdk1 관련 인 산화 사이트를 생성. 이 메서드는 순화 된 단백질에 의존, 이후 모든 모델 유기 체 및 수율 신뢰할 수 있는 결과에 적용할 수 있습니다. 그러나, 취득된 인 산화 사이트에는 생체 외에서 의 기능 확인은 권장, 셀 추가 규제 메커니즘 posttranslational 수정, 상호 파트너 또는 셀룰러 지역화 같은 장소에는 인 산화 사이트 액세스할 수 또는 Cdk1에 의해 인식에 대 한 액세스할 수 없게 렌더링 수 있습니다.

Cdk1 어디 X 어떤 잔류물 이며 떠들고 또는 트레오닌 인 산화의 사이트 (Ser/Thr-프로-X-리스/Arg), 구성 된 합의 인 산화 사이트를 인식 합니다. 특히 중요 한 인식에 대 한 + 1 위치에 프롤린의 존재가입니다. + 2 또는 3 위치에 기본적인 잔류물을 선호 하는 또한, 대부분 Cdk1 관련 인 산화 사이트는 + 3에서 리스 또는 Arg를 포함 위치6,12.

Cdk1의 활성화 긴밀 하 게 규제 하 고 유사 분열1,2,3,,45의 발병에 연결 됩니다.  종속 kinases의 활동 일반적으로 진동 세포 주기13전역 수준에서 표현 되는 뚜렷한 cyclins ( A, B, C, D, 그리고 E 인간에서), 그들의 연관에 따라 달라 집니다. Cdk1는 일정 한 세포 주기 고  A와 B5,13,,1415로  규제 소 단위와의 연결에 의존 하는 그것의 활동의 규제 뿐만 아니라 포스트 번역 상 수정. Cdk1/ B 복합체의 형성이 키 니 아 제 활성화5,14,15,,1617,18에 대 한 필요 합니다. G2 단계  B는 cytosol에서 번역 및 그것은 Cdk15,14,15,16,,1718; 바인딩 핵을 가져올 그러나, Cdk1/ B 인간 Cdk1 억제 kinases Myt1에 의해 Thr14와 Tyr15 잔류물에 인 산화 (멤브레인 관련 티로신, 트레오닌-특정 cdc2 억제 키)와 Wee1, 각각19, 사 개최 20,21. 늦은 G2 단계에서 세포 분열 주기 25 인산 가수분해 효소 (cdc25)에 의해 Thr14와 Tyr15의 dephosphorylation Cdk1/ B 복합의 키 니 아 제 활동을 활성화 하 고 유사 분열12,14, 의 개시를 유발 18 , 20 , 22 , 23. Thr161 인 산화는 Cdk1/ B 활성화에도 필요 하 고 Cdk7, Cdk 활성화 키 (케이크)18에 의해 중재입니다.  B anaphase에의 생긴다 Cdk1을, 유사 분열24,25에서 출구를 허용. Cdk1/ B의 활성화는 따라서 복잡 한 과정입니다. 여기에 제시 된 프로토콜 상용 Cdk1/ b 수행 곤충 세포에서이 복합물의 재조합 식 동안 활성화 된 vivo에서 생 kinases14,20 이며 순화 된 상태에서 활성 상태로 유지 합니다. 결과 활성화, 재조합 인간 Cdk1/ B는 생체 외에서 키 니 아 제 분석 실험에 적합 합니다.

여기, 우리는 인간의 centromere 단백질 F (CENP F)10Cdk1 관련 인 산화 위치의 식별에 대 한 프로토콜을 설명합니다. CENP-F는 대부분 interphase (g 1과 S 상)의 중 핵에 있는 g 2 단계26,27,28 , Cdk1 종속 방식으로10에 cytosol에 수출 하는 kinetochore 단백질 11. 핵 지역화26이 분 cNLS 의해 수 여. cNLSs 핵 전송 요소 karyopherin α karyopherin β 및 RanGDP, 핵29에 cNLS 화물의 수입 촉진에 의해 인식 됩니다. G2 단계에서 핵 수출10알 수 없는 수출 통로 통해 촉진 된다. CENP-F는 cytosol에 있는, 일단 핵을 모집 하 고 차례 차례로 모터 단백질 복잡 한 다30,31신병. 이 통로 mitotic 항목의 정확한 타이밍에 대 한 및 두뇌에 있는 근본적인 과정에 대 한 중요 한 다 종속 방식 mitotic 스핀 들 어셈블리의 초기 단계는 centrosome 각각 핵 위치 하는 것이 중요 하다 개발30,,3132. G 2 단계에서 시작 해 서, CENP-F 또한 조립 되는 kinetochore에 충실 한 염색체 분리27,28,,3334,35에 대 한 중요 한 역할을가지고 . 이 통로의 주요 규제 단계는 Cdk110,11에 따라 g 2 단계에서 CENP-F의 핵 수출 이다. 여기 CENP F. cNLS에 Cdk1-관련 인 산화 위치의 식별 프로토콜 설명 이 사이트의 Phosphomimetic 돌연변이 CENP-f, B Cdk1/ 직접 CENP-F의 그것의 cNLS10의 인 산화에 의해 세포 지역화 조절 제안 핵 가져오기 천천히.

전반적으로,이 생체 외에서 니 분석 결과 수 있습니다 특정 기판의 식별을 키 Cdk1 정화 대상 단백질 phosphorylated 생체 외에서 상용 Cdk1/ B 복합물 및 인 산화 사이트에 대 한 이후 질량 분석에 의해 식별 됩니다. Cdk1-특정 한 인 산화 위치의 식별 Cdk1 세포 주기를 제어 하는 방법을 계시 하는 기계 론 적인 연구를 지원 합니다.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. 단백질 시퀀스에서 Cdk1 관련 인 산화 위치의 예측

  1. 키 니 아 제 분석 실험을 시작 하기 전에 예측된 Cdk1 전용 인 산화 사이트에 대 한 단백질 시퀀스를 분석 하 고 알 수 없는 키도 실험적으로 설립된 인 산화 사이트에 대 한 문학을 검색 합니다. 사용 하 여 다음 도구, 데이터베이스, 및 요약 참조.
    1. IGPS 3.0 소프트웨어,3637 (http://gps.biocuckoo.org/online_full.php)를 사용 하 여 대상 단백질 시퀀스에서 Cdk1 관련 인 산화 사이트 예측. 여기 링크를 사용 하 여 이차 구조 및 표면 내게 필요한 옵션의 주석을 포함 하는 포괄적인 예측에 대 한.
    2. 소프트웨어, FASTA 형태로 단백질 시퀀스를 입력 합니다. 키 니 아 제 특이성에 대 한 떠들고/트레오닌 키 니 아 제, CMGC, CDK, CDC2, CDK1, 확인 하 고 다른 모든 특이성을 선택을 취소 합니다. 임계값으로 매체를 선택 하 고 전송 단추를 클릭 합니다.
    3. Cdk1 합의 인 산화 사이트 (Ser/Thr-프로-X-리스/Arg)와 결과 예측된 사이트를 비교 합니다.
    4. 중요 한 것은, phosphorylated 잔류물 (일부 Cdk1 기판 최소한의 사이트 (Ser/Thr-Pro)6,12에 phosphorylated는) 옆 프롤린에 대 한 예측된 사이트를 확인 하십시오. 또한, 선호 하는 + 2 또는 3 위치의 대부분 Cdk1 관련 인 산화 사이트 + 3 위치6,12에서 리스 또는 Arg를 포함 하는 기본적인 잔류물에 대 한 확인 합니다.
  2. 또한 확인 사이트 전체 합의 사이트의 존재로 인식에 대 한 접근은 Cdk1 인 산화에 대 한 충분 하지 않습니다.
    1. 표면 접근성 및 이차 구조 예측 주석 iGPS 출력 여부는 사이트 액세스할; 수 전망 이다 상태에서 검사 단백질의 N와 C 테르미니 많은 경우 유연 하 고 인 산화에 대 한 액세스할 수 있습니다.
    2. 대상 단백질의 x 선 구조를 사용할 수 있으면 구조에서의 위치를 검사 하 여 상 상속 인 산화 위치의 접근 가능성을 확인 합니다.
  3. 실험적 설립된 인 산화 사이트에 대 한 문학으로 알 수 없는 키 UniProtKB/스위스-보호 데이터베이스38 (http://www.uniprot.org)를 사용 하 여 검색 합니다.
    1. 단백질의 이름을 검색 상자에 입력 하 고 검색 버튼을 클릭 합니다. 올바른 시퀀스 항목을 선택 합니다. 인 산화 사이트 주석 하 고 아미노산 수정 섹션에서 참조 됩니다.
    2. Cdk1 세포 주기의 g 2 단계에서 활성화 됩니다 때문에 특히 유용 하다는 인간 세포 라인7,,3940, mitotic 추출의 proteomics 연구에 대 한 검색.
  4. 이 분 cNLS NLSmapper (옵션)로 식별 합니다.
    참고: 셔틀은 cytosol와 핵 단백질에 대 한 세포질 지 방화의 규칙에 대 한 일반적인 메커니즘 Cdk1에 의해 주요 모티브의-1 위치에이 분 cNLS의 인 산화는. 인 산화 핵 지역화 g 2 단계10,41,,4243곧.
    1. 이러한 왕복 단백질 단백질 시퀀스에서 cNLS NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi)에 의해 식별 합니다. 텍스트로 단백질 시퀀스 순서 상자에 붙여 넣습니다, 그리고 5.0의 커트 오프 점수를 선택 하 고 전체 지역에 NLS에 대 한 검색 하기로. 예측 NLS 를 클릭 합니다.
    2. 이 분 cNLS, 이루어져 있는 작은 모티브 (리스-Arg), 적어도 10 잔류물의 링커 및 주요 모티브 (리스-리스/Arg-X-리스/Arg), 여기서 X는 부정 청구 되지 어떤 잔류물 든 지의 합의 시퀀스에 대 한 예측된 결과 cNLS 비교 .
    3. 만약 예측된 Cdk1 인 산화 사이트 (*)는 인접해 링커의-1 위치에 주요 주제를 확인: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      참고:이 분 cNLS Cdk1에 의해-1 위치에의 인 산화는 여러 셔틀 단백질10,,4142, 에 대 한 셀룰러 지역화에 대 한 규제 메커니즘으로 설립 되었다 43.

2. 대장균 에서 재조합 단백질의 표현

  1. 단계 2.1.1-2.1.2에서 식 플라스 미드를 사용 하 여 대장균에서 재조합 형 단백질의 표정을 위해.
    1. 전체 길이 CENP F 구문에서 생성 삽입 연쇄 반응 (PCR)에 의해 DNA 파편을 증폭 시켜으로 만드는 인간 CENP-F (잔류물 2,987-3065) 식 구성, (은행 취득: U19769.1). 다음 프라이 머를 사용 하 여: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG 및 AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      주: 전체 길이 인간의 CENP F 플라스 미드 아낌없이 박사 X. Zhu, 생물 과학, 중국 과학원, 상하이, 중국에 대 한 기관에 의해 제공 되었다.
      1. BamHI 및 XhoI 금지 사이트와 pGEX6p1 벡터에 삽입을 복제할. 이 플라스 미드를 사용 하 여 CENP-F (잔류물 2,987-3065)의 N 맨끝 티 S-전이 효소 (GST) 융해 단백질을 표현 하.
        참고: GST-태그 수 수 떨어져 죽 습 PreScission 프로 테아 제 (이제부터 PS 효소 라고도 함)에 의해.
    2. 인간의 karyopherin α 식 구성에 대 한 전체 길이 karyopherin α2 cDNA 템플릿에서 PCR에 의하여 DNA 파편을 증폭 시켜 삽입을 생성 (시퀀스 취득 NM_002264.3; 뇌관: GCACTACATATGTCCACCAACGAGAATGCTAATA 및 TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC)입니다.
      참고:는 isoforms의 유사성으로 인해이 karyopherin α2 구문 이라고를 후속 텍스트에서 karyopherin α.
      1. NdeI 및 XhoI 금지 사이트와 pET28a 대가로 벡터에 삽입을 복제할.
        참고:이 수정된 pET28a 벡터는 PS 효소 분열 사이트에 대 한 인코딩 시퀀스에 의해 대체 되었다 트 롬 빈 분열 사이트에 대 한 인코딩을 하는 시퀀스입니다. 이 플라스 미드를 사용 하 여 그의6의 N 맨끝으로 karyopherin α 융합 단백질을 표현-태그, 어디에 그의6-태그 수 있습니다 PS 효소에 의해 떨어져 죽 습 수.
  2. 포인트 대상 단백질의 돌연변이만들려면 키트 mutagenesis 사이트 감독을 수행 합니다.
  3. 이후 정화에 대 한 대장균 에서 재조합 단백질을 표현 한다.
    1. 다음 주식 확인: 50 mg/mL 대 (1:1, 000 재고 솔루션), 70% 에탄올 (1:1, 000), 100 mg/mL 암 피 실린 (1:1, 000), 그리고 1 M 이소프로필 β-D-1-thiogalactopyranoside (IPTG; 1:5, 000)에서 35 mg/mL 페니.
    2. 멸 균 필터 주식 및-20 ° c.에 저장 IPTG 반복된 freeze-thaw 주기를 하지 마십시오.
    3. 제조업체의 지침에 따라 대장균 로제타 2 (DE3) pLysS 긴장의 유능한 세포의 50 µ L로 식 플라스 미드의 1 µ L를 변환.
    4. 페니 (35 µ g/mL 파운드)와 한 천 Luria Bertani (파운드) 및 암 피 실린 (100 µ g/mL 파운드) CENP-F 구문, 또는 페니 karyopherin α 구문 대 (50 µ g/mL 문화)에 대 한 문화 접시 12-20 h 37 ° c.에 대 한 번호판을 품 어
    5. 단일 식민지를 선택 하 고 (단계 2.3.4 참조) 항생제로 보충 하는 파운드의 50 mL를 접종. 12-20 h 37 ° c.에 대 한 160-180 rpm에서 동요 하는 동안 preculture를 품 어
    6. 준비 1 L 파운드의 2800 ml에서 매체 Fernbach 플라스 크를 당황 하 게. 각 preculture 및 오토 클레이 브에 대 한 두 개의 플라스 크를 만들 그들. 통 기 통풍을 허용 하려면 플라스 플라스 크 볼륨의 2/3 이상 채우지 마십시오. 삼각 플라스 크도 사용할 수 있습니다.
    7. 항생제 (2.3.4 단계)와 살 균 필터 40% (w/v) 포도 당 솔루션의 LB 매체 1 L 당 preculture의 냉각된 파운드 추가 20 mL의 1 L 당 10 mL를 추가 합니다.
      참고: 600에서 흡 광도 1:10 희석 된 preculture의 0.15-0.2 사이 여야의 nm.
    8. 동안 37 ° c.에 160-180 rpm에서 떨고 있는 플라스 크를 품 어 600에서 흡 광도 측정 박테리아 문화를 정기적으로의 nm. 경우는 흡 광도 0.5-0.6, 0.2 m m IPTG을 추가 하 여 단백질 표정 유도 (파운드 매체의 1 L 당 1 M의 200 µ L).
      참고: 셀 올바른 흡 광도에서 유도 된다 중요 하다. 보통이 단계에 도달 하는 3-4 h 걸립니다.
    9. 37 ° c.에서 3 h 동안 흔들어 동안에 플라스 크를 품 어 원심 (15 분, 4100 x g, 4 ° C, 스윙 아웃으로 터)에 의해 세포를 수확. 폐기는 상쾌한. 20 mL GST 바인딩 버퍼 (CENP-F) 또는 그의6셀 펠 릿 resuspend-문화의 1 L 당 바인딩 버퍼 (karyopherin α). -80 ° c.에서 셀 저장
      1. GST 바인딩 버퍼 (10 mM Tris pH 8.0 25 ° c, 150 mM NaCl, 1 m m dithiothreitol (DTT), 0.5 m m EDTA) 준비와 그의6-버퍼 (10 mM Tris pH 8.0 25 ° c, 250 m NaCl, 5mm 이미 pH 8.0 m 5 m m β-mercaptoethanol (공학은))를 사전에 바인딩.

3. 티 친화성 크로마토그래피와 젤 여과 하 여 재조합 형 단백질의 정화

  1. 다음 주식 확인: 1 M DTT (1:1, 000 주식, 무 균 0.2 µ M 기 공 크기, 필터링 및 degassed); 250 m m phenylmethylsulfonyl 불 (PMSF; dimethylsulfoxide에서 1:1,000 재고) -20 ° c.에 게 반복적인된 동결-해 동 주기를 하지 마십시오.
  2. 다음 버퍼를 만들고 4 ° c 냉각
    1. 10 mM Tris pH 8.0을 사용 하 여 25 ° c, 150 m m NaCl, 1 mM DTT, 0.5 m m EDTA GST 바인딩 버퍼 를 준비 합니다.
    2. 50 mM Tris pH 8.0 25 ° c, 150 m m NaCl, 1 mM DTT의 버퍼에 녹아 10 m m 감소 티 (0.15 g/50 mL)을 사용 하 여 GST 차입 버퍼 를 준비 합니다. 마지막 버퍼의 pH 8.0은 확인 하 고 사용 되었다 같은 날에.
    3. 25 ° c, 60 m m NaCl, 2mm DTT 20 mM Tris pH 7.5를 사용 하 여 젤 여과 버퍼 를 준비 합니다. 멸 균 병 상단 필터 (0.2 µ M 기 공 크기) 버퍼를 필터링 합니다. 15 분 동안 진공 (-6 psi)에서 교 반 하면서 버퍼 드
    4. 사용 당일 버퍼 위의 모든 DTT를 추가 합니다.
  3. CENP-F 구조를 포함 하는 섹션 2에서 셀 동 GST 바인딩 버퍼와 40 mL를 볼륨을 조정 합니다. 1mm DTT, 0.25 m m PMSF, 0.5 m m (0.5 M 재고 솔루션, pH 8.0), EDTA 추가 7 mg benzamidine 염 산 염 (1 m m), 그리고 40 mg d / 메티오닌.
    참고: 분해 저하를 줄이기 위해, 모든 단계 수행 4 ° c, 차가운 방에 선호, 다른 설명이 없는 한. 항상, 셀, lysates, 및 얼음에 순화 된 단백질 분수를 유지 하 고 protease 억제제를 추가. 시스테인과 메티오닌 잔류물의 산화 방지, 실험 당일 DTT, 메티오닌 등 reductants을 추가 합니다. 위하여 저하를 줄이기 위해, 신속 하 게 단계를 통해 작동 합니다.
  4. Lyse 으로 sonicator 셀 다음과 같습니다. lysate를 유리 비 커를 얼음 물 탕에 젖어 있습니다. (1 분 40 s, 100 W (50%) 출력/진폭, 10 s 펄스와 10 s 나머지 사이클에서) 문화 sonicate 250 µ M PMSF 쥡니다 후 추가 합니다. 세포 lysate, 더 투명 한 모양과 더 이상 점성 수를 검사 합니다.
  5. 명확한 lysate centrifuging 12000-40000 x g, 25 분, 4 ° c.에 의해 라운드-하단 원심 분리기 튜브와 고정된 각도 터를 사용 합니다.
  6. 재래식 일회용 크로마토그래피 열 티 agarose 1:1 슬러리의 2 개 mL를 추가 하 여 수행 합니다. 결과 열 1 mL의 볼륨을 가질 것 이다. 25 mL 초순과 25 mL GST 바인딩 버퍼의 열을 씻어.
  7. 다음과 같이 바인딩 을 수행 합니다. 차가운 방 또는 찬 상자에서 작업, 알 약에서 lysate 가만히 따르다. 연결된 열에 부 어 및 lysate (0.2 µ m 기 공 크기)를 필터링 합니다. 뚜껑 열과 부드럽게 nutating 4 ° c.에 30 분 동안 품 어
  8. 세척 하는 선반에 그것을 넣어 열 수 지 정착, 그리고를 통해 흐름을 수집 하자. GST 바인딩 버퍼의 25 mL로 두 번 열을 씻어.
  9. 분해 분열에 의해 elute.
    1. 열을 연결 합니다. GST 바인딩 버퍼의 400 µ L 및 PS 효소 (2 mg/mL 주식 1000 U/mg의 활동 중 실험실에서 정화 또는 구입; 테이블의 자료를 참조)의 250 µ L를 추가 합니다.
    2. 뚜껑을 열 고 부드럽게 버퍼에 수 지를 resuspend에 소용돌이. 16-20 h 4 ° c.에 대 한 열을 품 어 다음 열에서 proteolytically 쪼개진된 CENP F 조각 elute GST 바인딩 버퍼의 4 mL를 추가 합니다.
  10. 티 차입
    1. 열 연결 GST 차입 버퍼 (4 열 개)의 4 개 mL를 추가 하 고 바운드 GST 태그 elute를 10 분 동안 품 어. eluate를 수집 합니다. 제조 업체에 의해 설명 된 대로 다시 사용 하기 전에 열을 다시 생성 합니다.
  11. PS protease 차입 분수와 16% 아크릴 아 미드 젤에 SDS 페이지 티 차입 분수를 분석 합니다. Coomassie 블루 젤 45 분 얼룩에 대 한 25 V/cm에서 전기 영동을 수행 합니다. 티 분수 쪼개진된 GST 태그 포함 되지만 PS protease 분수 순화 CENP F 조각을 포함 됩니다. 위하여 분열 효율성을 평가 하기 위해 젤을 검사 합니다.
  12. 0.5 ml 3 kDa 분자량 컷오프와 원심 필터 단위를 사용 하 여 효소 eluate PS 집중 ( 재료의 표참조). 필터의 위쪽 구획에는 eluate를 추가 하 고 4100 x g, 샘플 집중 하 4 ° C (스윙 아웃으로 터)에서 10-15 분 단위로 원심. 각 증가 후 pipetting으로 혼합.
  13. 적당 한 여과 열 젤 연결 (구매 정보에 대 한 재료의 표 참조) 고속 단백질 액체 착 색 인쇄기 (FPLC) 시스템, 1 열 볼륨 젤 여과 버퍼의 equilibrate 그리고.
  14. Microcentrifuge (20 분, 21,700 x g, 4 ° C)에 집중된 CENP F 조각 원심 열에 넣기 예제와 젤 여과 버퍼의 1 열 볼륨 elute. 0.6 mL 분수를 수집 합니다.
    참고: 젤 여과 버퍼 후속 키 분석 결과와 호환성을 위해 최적화 됩니다. 테스트 대상 단백질이이 버퍼에 안정 되어 있는 경우. 그것은 안정 되어 있는, 더 많은 염화 나트륨을 추가 해보십시오.
  15. SDS 페이지 (3.11 단계)에 의해 피크 분수를 분석 합니다. 순수한 CENP-F 파편을 포함 하는 피크 분수 풀. 3.3 mg/mL (3.12 단계)를 순화 CENP F 파편을 집중 을 한다. SDS 페이지 (3.11 단계)에 의해 순화 CENP F 파편을 분석 합니다.
  16. 단백질 농도 결심
    1. 초순에 샘플 1: 100 희석 하 고 석 영 마이크로-베트에 배치. 분 광 광도 계에 220-300 nm의 파장 범위에서 스펙 하 트 레코드 라
      참고: 단백질 농도 c (mg/mL) 다음 식에서 파생 된다:
      Equation
  17. 순화 된 단백질의 50 µ L aliquots 0.5 mL microtubes 및 플래시 동결 을 액체 질소에 그들. -80 ° c.에 aliquots 저장

4. Ni NTA 친화성 크로마토그래피에 의해 재조합 형 단백질의 정화

  1. 다음 버퍼를 만들고 멋진 4 ° c
    1. 준비는 그의6-바인딩 버퍼 25 ° c, 250 mM NaCl, 5mm 이미 pH 8.0, 5mm 공학은 10 mM Tris pH 8.0을 사용 하 여. 사용 당일 공학은 모든 버퍼에 추가 합니다.
    2. 준비는 그의6-워시 버퍼 는 그의 같은 방식으로6-버퍼 바인딩 하지만 20mm 이미를 사용 하 여.
    3. 준비는 그의6-차입 버퍼 바인딩 버퍼 하지만 150mm 이미를 사용 하 여 같은 방식으로.
  2. 생성 하 고는 그의 40 mL에 볼륨 조정 karyopherin α를 포함 하는 섹션 2에서 셀을 녹여 6-바인딩 버퍼. 5mm 공학은, 0.250 mM PMSF, 7 mg benzamidine 염 산 염 (1 m m), 및 40 mg d / 메티오닌 추가 합니다.
    1. 다음 변형을 3.4-3.8 단계에서 설명한 대로 진행:6그의 사용-모든 단계에 대 한 GST 바인딩 버퍼 대신 바인딩 버퍼. 티 agarose 대신 사용 니켈 선호도의 4 mL 젤 ( 재료의 표참조) 2 mL의 열 량을가지고 것입니다 열.
      참고: 니켈 선호도 열 DTT와 EDTA와 호환 되지 않습니다. 니켈 선호도 젤 대신 Ni2 +-nitrilotriacetic 산 (NTA) agarose 경우 사용할 수 있습니다, 차입 버퍼에 이미 농도 250 m m로 증가 ( 자료 표참조).
  3. 워시는 의 그의68 mL와 열-워시 버퍼.
  4. 그의6의 12 mL와 함께 Elute karyopherin α -차입 버퍼 및 SDS 페이지 (단계 3.11) eluate 분석.
  5. PS protease의 추가 250 µ l (단계 3.9)는 eluate 하 고 16-20 h 4 ° c.에 품 어 한편, 두 번에 대 한 그의6의 1 L eluate dialyze-2-20 h는 6-8 kDa 분자량 컷오프 투 석 막 사용에 대 한 바인딩 버퍼.
  6. 제조 업체에 의해 설명 된 대로 니켈 선호도 젤 열을 다시 생성 합니다. 그의625 mL와 열 equilibrate-바인딩 버퍼. Dialyzed 단백질은 열을 추가 하 고 단계 3.7에서에서 설명한 대로 바인딩 단계 를 수행 합니다.
  7. 를 통해 흐름을 수집, 순화 karyopherin α를 포함 (는 그의6-태그 떨어져 죽 습), 그리고 그의6의 추가 4 mL와 함께 남은 단백질을 elute-바인딩 버퍼. 이 분수를 풀. 그런 다음 그의6의 12 mL와 함께 열을 elute-차입 버퍼. 이 분수는 불순물을 포함합니다.
  8. 분석 단계 4.4-4.5에서에서 uncleaved 및 쪼개진 karyopherin α와 SDS 페이지 (단계 3.11) 그의6의 효율성을 평가 하 여이 단계에서 두 차입 분수-절단, 순도 태그.
  9. 8 mg/mL 및 플래시 동결 에 액체 질소 (3.15-3.17 단계) karyopherin α 집중 을 한다.

5. 시험관에서 키 분석 결과 Cdk1/ B

  1. 키 니 아 제 분석 실험 체 외에
    참고:는 키의 도착, 작은 aliquots, 플래시 동결 그들 액체 질소에 만들고-80 ° c.에서 그들을 저장합니다 6 개월 이내에 사용 합니다. 분자 무게는 Cdk1에 대 한 34 kDa  b 48 kDa, SDS 페이지  B의 명백한 분자량 약 60 kDa 이다.
    1. PK (고 니와 함께 제공 된) 버퍼를 사용 하 여 x 10 준비 0.5 M Tris HCl, 0.1 m M MgCl2, 1 mM EDTA, 20mm DTT, 0.1% Brij 35, 25 ° c.에 pH 7.5
    2. ATP 주식 x 10을 준비: PK 버퍼, x 1에 4 mM ATP의 솔루션을 확인 하 고 재고의 최종 pH를 확인. -20 ° C에서 작은 aliquots에 저장 하 고 동결-해 동 주기를 피하기 위해.
    3. CENP-F의 믹스 40 µ L 조각 (3.3 mg/mL, 또는 400 µ M의 농도)에 PK 버퍼, 3 µ L의 초순, 6 µ L ATP 10 배 재고, 그리고 인간의 5 µ L x 6 µ L 10 Cdk1/ B (1 µ g, 100 U) 0.5 mL microtube에.
      참고: CENP F 조각 8.6 kDa와 4 Cdk1 전용 인 산화 사이트의 어 금 니 질량은 이다. 새로운 기판에 대 한 분석 결과 및 인 산화 위치의 수에 따라 단백질의 어 금 니 농도 따라 니 농도 조정 합니다. 재조합 인간 Cdk1/ B 주식의 활동 20000 U/mL, 그리고 특정 활동 1000000 U / mg. 1 U Cdk1/ B Cdk1 펩 티 드 기질 PKTPKKAKKL-NH2 1 pmol 인산 염의 이전을 촉매 하는 데 필요한 금액으로 정의 (50 µ M) 30 ° C에서 1 분에 ( 재료의 표참조).
    4. 1-16 h 30 ° c.에 대 한 Cdk1/ B. 품 없이 제어 반응 반응 물 욕조에 준비
  2. 키 니 아 제 분석 실험 반응의 2.5 µ L 분석 SDS 페이지 (3.11), 단계에 의해 컨트롤의 2.5 µ L 16% 아크릴 아 미드 젤을 사용 하 고. 해상도 늘리려면 실행 시간을 확장 합니다.
  3. 나머지 키 분석 결과 반응 (및 컨트롤) 6 M guanidine 염 산 염 솔루션의 동일한 볼륨을 추가 합니다. 마지막 guanidine 염 산 염 농도 3 M. 질량 분석 (제 6 항) 인 산화 사이트 식별 또는 분석, 질량 분석 시설에 샘플을 보내 다음 기능 확인 (수행 하 여이 샘플을 분석 될 것 이다 섹션 7)입니다.
    참고: 후속 질량 분석 분석을 위해 매우 중요 하다는 개별 사이트의 인 산화 효율, 높은 선호 100%,으로 인 산화 위치를 매핑할 수 없습니다. 크게 인 산화 효율성 향상, Cdk1/ B의 더 큰 금액을 추가 하 고 16 h 배양 시간을 증가. 또한 ATP의 농도 두 배로 수 있습니다.
  4. 문제 해결을 위한 긍정적인 컨트롤로 CENP-F (잔류물 2,987-3065)의 체 외에 키 니 아 제 시험을 수행 합니다. Cdk1/ B의 신선한 배치를 사용 하 여 높은 활동.

6. 질량 분석에 의해 인 산화 Cdk1 특정 사이트의 식별

  1. 변성 단백질 견본 desalt PLRP300 열과 microbore 역 상 액체 크로마토그래피 를 수행.
  2. CENP-F 조각에 인 산화 위치의 수를 분무 이온화 이온 트랩 질량 분석 (ESI-ITMS)44,45는 그대로 체 외에 phosphorylated CENP F 84-메 르 분석.
  3. CENP-F의 phosphoamino 산 사이트 위치를 평가 하는 체 외에서트립 신 다이제스트 준비 CENP F 단백질 견본 phosphorylated. 담 피펫으로 팁과 트립 신 다이제스트 desalt.
  4. 분무 이온화 푸리에 이온 싸이 클 로트 론 공명 질량 분석 (MS ESI FTICR) 변환에 의해 CENP-F의 tryptic 다이제스트를 분석 합니다. 169 µs의 축적 시간 ESI FTICR 질량 분석기에서 분석을 수행 합니다.
    참고: 0.005 amu 내의 대 중 ESI FTICR MS에 의해 결정의 정확도 이다. 총 단백질 양을 각각 phosphorylated 각 종의 비율 계량, 질량 스펙트럼의 피크 높이 결정 합니다.

7. 기능 검증: 단백질-단백질 상호 작용 분석 크기 배제 크로마토그래피에 의해에 Phosphomimetic 돌연변이의 효과 테스트

참고: 위해 확인 된 Cdk1 관련 인 산화 위치의 기능 검증 확인 된 인 산화 사이트 aspartates 대체 하 여 CENP-F 파편의 phosphomimetic 돌연변이 생성 . Aspartate의 네거티브 차지 인 산화의 효과 모방합니다. CENP-F 조각 (잔류물 2,987-3065)의 S3048D 돌연변이 만들었습니다.

  1. 기능 검증, 야생-타입의 바인딩 비교 및 karyopherin α. phosphomimetic CENP F 파편 분석 젤 여과 사용 하 여 바인딩 분석 결과로. 분석 젤 여과 대 한 티 친화성 크로마토그래피 (단계 3.1-3.12)에 의해 CENP F 파편 을 정화 하 고 젤 여과 단계를 건너뜁니다.
  2. 5-6 mg/ml 단백질을 집중 한다. 플래시-동결 단백질 aliquots 액체 질소 (3.15-3.17 단계).
  3. 믹스 순화 CENP F 조각 (0.1 mg, 야생-타입 또는 S3048D 이체) 및 1:1 어 금 니 비율에서 karyopherin α (0.7 mg)를 정화. 젤 여과 버퍼 200 µ L에 샘플 볼륨을 조정 합니다. 얼음에 30 분에 대 한 샘플을 품 어, 샘플 (0.2 µ m 기 공 크기), 필터, 원심 분리 (25 분, 21,700 x g, 4 ° C) 하 여 샘플을 취소
  4. 샘플에 크기 배제 크로마토그래피에 의해 (단계 3.13-3.14) 구분 합니다. 20 mM HEPES, pH 7.5, 150 m NaCl, m 및 2 m m DTT의 구성 된 젤 여과 버퍼를 사용 합니다. 모든 샘플에 대 한 동일 조건에서 분석 젤 여과 실험을 수행 합니다.
  5. 제조 업체에 의해 설명 된 대로 알려진된 분자량의 고분자 중량 기준 분석 젤 여과 열 보정.
  6. 16% 차입 분수 분석 SDS 페이지 (단계 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

최근 포함 cNLS10CENP-F 조각에서 Cdk1 관련 인 산화 사이트를 식별 하는 생체 외에서 니 분석 결과 (그림 1) 사용 했습니다. 이 신호는 대부분의 interphase 동안 CENP F의 핵 지역화를 수 여. G2 단계에서 CENP F Cdk1 종속 방식에서 cytosol에 핵에서 수출 된다. Cdk1 CENP-F의 셀룰러 지역화를 조절 하는 방법에 대 한 기계적 통찰력을 얻으려면, 우리는 iGPS 서버36,37을 사용 하 여 CENP-F Cdk1-관련 인 산화 위치를 예측 하기의 순서 분석. CENP F cNLS, 내 세 Cdk1 관련 인 산화 사이트 예측 했다 3,042, 잔류물에서 3045, 및 3,048 (표 1). 또 다른 Cdk1 인 산화의 사이트 또한 잔류물 3,007 (표 1)10에 대 한 예언 되었다. 따라서, 우리는 Cdk1의 cNLS의 인 산화에 의해 직접 CENP F 지역화 조절 가설.

16%에 CENP F cNLS는 Cdk1에 대 한 기판, 순화 된 인간의 CENP F fragment (잔류물 2,987-3065)로 체 외에 니 시험 수행 및 인간 Cdk1/ B. 생체 외에서 CENP F phosphorylated 여부를 테스트 하려면 분석 SDS 페이지 키 니 아 제 Cdk1 부족 부정적인 컨트롤과 함께 (그림 2A)10. 생체 외에서 CENP F phosphorylated, 대 한 부정적인 컨트롤에 비해 젤에 밴드에 대 한 명확한 상승 변화 관찰 됩니다. 이것은 phosphorylated 단백질의 전형적인 두 부정적인 요금 및 추가 대량 추가 하는 각 인산 염 그룹입니다. 이러한 결과 CENP F Cdk1/ B10phosphorylated는 건의 한다.

CENP-F 인 산화 위치의 수를 결정 하 고이 사이트의 인 산화 효율 척도를 그대로 체 외에 phosphorylated CENP F 조각 (84-메 르) 질량 분석 (ESI-ITMS)10에 의해 분석 되었다. 관찰 된 ESI 이온 트랩 질량 스펙트럼 (그림 2B) 그대로 CENP F 조각 4 개의 사이트 (표 1)10에 phosphorylated은 나왔다.

CENP-F의 순서에 phosphorylated 아미노산 사이트의 위치에 의해 평가 되었다 lysines 및 arginines, 후 단백질 사슬을 고대의 ESI FTICR 양 트립 신에 의해 tryptic 요약을 검토 하 고 CENP F 파편의 트립 신 다이제스트 결과 여러 펩타이드, 3,031-3, 052 잔류물을 포함 하는 것을 포함 하 여 이 CENP F 펩 티 드의 질량 스펙트럼 잔류물 T3042, T3045, 및 S3048, cNLS (표 1)10있는에 인 산화와 일치 했다. 또 다른 tryptic 펩 티 드 (잔류물 2995-3,016)의 질량 스펙트럼에 S3007 인 산화와 일치 했다 (표 1)10. 모든 4 개의 Cdk1-관련 인 산화 사이트 또한 시퀀스에서 예측 했다. Cdk1 전용 기판 종종 포함 옆에 phosphorylated6, 잔류물 프롤린 잔류물 T3042, T3045, 및 S3007에 대 한 관찰. 그것은 주목 해야한다 S3048는 다소 특이 한 Cdk1 관련 인 산화 사이트는 페닐알라닌 옆에서 떠들고 있는. 결론, 결과 CENP-F 키 Cdk1에 의해 잔류물 3,007, 3,042, 3,045, 및 3,048에서 특히 phosphorylated는 것이 좋습니다. 이러한 잔류물의 3 CENP-F (표 1), Cdk1 CENP F Cdk1 때 활성10g 2 단계에는 cNLS의 인 산화를 통해 셀룰러 지역화를 조절 수 있습니다 나타내는의 cNLS 안에 있습니다.

이 Cdk1 관련 인 산화 위치는 생리 기능을 확인 하려면 phosphomimetic 변형 S3048D10만들었습니다. Phosphomimetic 돌연변이 부정적으로 위탁 된 잔류물에 의해 인 산화의 효과 모방. 다음으로, 우리는 cNLS 포함 CENP F 조각의 phosphomimetic 버전 정화. CENP F cNLS 핵 수송 수용 체 karyopherin α, 높은 선호도와 바인딩하고 CENP f. 핵 가져올 필요는 의해 인식 된다 Phosphomimetic 돌연변이 핵 수송 수용 체 karyopherin α와 CENP f cNLS 사이 상호 작용을 약화 하는 여부를 테스트 하려면 우리 수행 바인딩 분석 결과 (그림 3)10. 이 실험에서 순화 CENP F 조각 (야생-타입 또는 S3048D 이체) 순화 된 인간의 karyopherin α와 함께 혼합 했다 고 혼합물 분석 크기 배제 크로마토그래피에 의해 분리 되었다. 더하여, 단백질은 개별적으로 분석 또한 되었다. 차입 분수의 SDS 페이지 분석이 밝혔다 그는 cNLS와 야생-타입 CENP F 조각 강하게 상호 작용 karyopherin α, 이후 두 단백질 공동 elute (그림 3)10. 그러나, 무시할 수 양의 CENP F S3048D 조각 karyopherin α를 한다이 단백질 elute 별도로 (그림 3)10. 이러한 결과 인 산화 제안 잔류물의 CENP F cNLS의 3,048 핵 전송 요소 karyopherin α와의 상호 작용에 강한 영향을 했. 그것은 핵 가져오기 요금은 높은 핵 전송 요소46, 향해 핵 지 방화 신호의 선호도에 따라 그리고 그러므로, 이러한 돌연변이 핵 가져오기10천천히 예상 된다 주목 해야한다.

Figure 1
그림 1: 니 분석 결과 생체 외에서 Cdk1의 도식 대표. 이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.

Figure 2
그림 2: CENP F Cdk1/ b. phosphorylated (A) Cdk1 인 산화 특정 사이트, 생체 외에서 키 니 아 제 분석 실험을 수행한 정화 CENP-F (잔류물 2,987-3065)로 확인. SDS 페이지 분석 Cdk1/ B 없이 부정적인 컨트롤의 왼쪽된 차선에서 표시 됩니다 (-Cdk1), 옆에 오른쪽 차선 (+ Cdk1) CENP-F phosphorylated 생체 외에서 . 분자 무게 기준은 표시 됩니다. SDS 페이지에 phosphorylated CENP-F의 상승 교대 note는 성공적인 인 산화와 일치. Cdk1 및  B 34 kDa과 60 kDa에 희미 한 밴드로 표시 됩니다. (B) 그대로 phosphorylated CENP-F (A)에서 ESI 이온 트랩 질량 분석 그대로 phosphorylated CENP-F (84-메 르)의 인산 염 부하를 결정 하는 데 사용 되었다. 해당 질량 스펙트럼 표시 됩니다. 강도 질량 대 전 비 (m/z) 대 플롯 됩니다. 스펙트럼 인 산화 후 그대로 CENP F 조각의 14 충전 상태에 + 10을 표시합니다. 그들은 종 인구 0, 1, 2, 3, 4 인산 염 에스테 르를 나타냅니다. 각각의 종족의 총 단백질 금액 비율 계량, 피크 높이 결정 하 고 비교 (표 1). 이 그림10 에서 수정 되었습니다 그리고 테일러 및 프란시스 게시자에 의해 허가로 재현 됐다. 이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.

Figure 3
그림 3: 기능 검증: CENP f phosphomimetic 돌연변이 강하게 핵 수송 수용 체 karyopherin α와의 상호 작용 감소. (A-F) CENP-F 조각 (잔류물 2,987-3065) 정화 (0.1 mg) 및 정화 karyopherin α (0.7 mg)와 1:1 어 금 니 비율에 혼합 되었고 크기 배제 크로마토그래피에 의해 분석. CENP-F 조각과 karyopherin α도 개별적으로 분석 했다. 피크 분수의 SDS 페이지 분석 표시 됩니다. 차입 볼륨 (0.6 mL 단위로) 하단에 표시 됩니다. 왼쪽에, kDa 분자량 마커 밴드와 그들의 질량의 위치가 표시 됩니다. 별표는 잔여 GST (glutathione S-전이 효소)의 흔적을 표시합니다. (A) 프로필 Karyopherin α. (B) 차입. 280에서 흡 광도 nm 차입 볼륨 대 그려집니다. Karyopherin α (빨간색)에 대 한 차입 프로필 karyopherin α CENP F 파편의 혼합물의 차입 프로필 중첩 (야생-타입: 녹색; phosphomimetic S3048D 돌연변이: 블루). 야생-타입 CENP F 조각의 추가와 CENP F 야생-타입 파편의 바인딩 일치 하는 높은 질량에 karyopherin α 피크의 차입 볼륨 이동 note. Phosphomimetic 돌연변이 karyopherin α. (C) CENP-F 야생-타입 조각 (wt)와 CENP-F의 상호 작용을 크게 감소 한다 제안으로 phosphomimetic 돌연변이 S3048D와 CENP-F 조각 추가 될 때이 변화 하지 관찰 및 karyopherin α. (D) CENP-F wt 단편입니다. (E) CENP F S3048D 조각 및 karyopherin α. (F) CENP F S3048D 조각화. 이 그림10에서 데이터를 만들었습니다. 이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.

테이블 1A입니다. 조각의 CENP F (잔류물 2987-3065)와 시퀀스 예측 Cdk1 전용 인 산화 사이트를 더 큰 글꼴 크기에 의해 강조 했다. Tryptic 파편은 굵게 강조 표시 하 고 밑줄.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
표 1B입니다. 그대로 CENP F의 질량 분석 분석
생체 외에서 인 산화 Cdk1/ b 후 84 메 르
위치의 인 산화 (P) 감지 # 인산 염 부하 총 단백질의 %로 표시
CENP-F 2987-3065 0 P 6%
1 P 37%
2 P 40%
3 P 15%
4 P 3%
테이블 1C. 후에 생체 외에서 인 산화 Cdk1/ b CENP F의 tryptic 펩 티 드의 질량 분석 분석
인 산화 위치의 # 인산 염 부하
Tryptic phosphopeptide 0 P 57%
잔류물 2995-3016 1 P 43%
Tryptic phosphopeptide 0 P 7%
잔류물 3031-3052 1 P 64%
2 P 29%
3 P 1%

표 1: 체 외에 인 산화 Cdk1/ b 후 분석 분석 CENP F 조각의 질량 이 테이블 데이터10를 만들었습니다.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

우리의 생체 외에서 니 분석 결과 세포 주기의 마스터 컨트롤러 및 많은 중요 한 세포질 과정을 조절 키 Cdk1를 위한 분자 표적을 식별 하는 매우 강력한 방법입니다. 메서드는 순화 된 단백질 Cdk1에 대 한 기판 이며 수 인 산화 특정 사이트의 경우 결정 합니다. 이 Cdk1 통해 인 산화에 의해 세포 프로세스의 규칙을 위한 기계 연구를 촉진 한다.

질량 분석에 의해 인 산화 위치의 성공적인 식별에 대 한 가장 중요 한 요소 니 분석 결과의 인 산화 효율입니다. 개별 사이트의 인 산화 효율 이어야 한다, 높은 선호 100%. 이 Cdk1/ B의 양을 증가 하 고 16 h 배양 시간에 의해 얻을 수 있습니다. 때 Cdk1/ B, 단백질과 사이트를 고려해 야 하는 인 산화 수의 어 금 니 농도의 양을 계산 합니다. 이것이 여러 인 산화 위치는 대상 단백질에 존재 하는 경우에 특히 중요 합니다. 그것은 상업 Cdk1/ B의 활동 배치에서 배치, 다 수 고는 키 니 아 제 활동을 빠르게 잃을 수 있습니다 주목도 한다. 인 산화 체 외에 실패할 경우는 키 니 아 제 활동을 테스트 하는 것이 좋습니다. 문제 해결을 위한 긍정적인 컨트롤로, CENP-F (잔류물 2,987-3065)의 인 산화 체 외에서 사용할 수 있습니다. 부정적인 통제로 Cdk1/ B 추가 없이 반응 해야 수행 되며 분석. 또 다른 유용한 부정적인 통제는 촉매로, 간단한 점 돌연변이 (D146N)47,,4849인 Cdk1의 키-죽은 돌연변이의 사용 이다. 또한, 확인 된 인 산화 위치를 확인 하려면 대상 단백질의 phosphonegative 버전을 만들 수 있습니다, 인 산화 사이트 alanines에 의해 대체 됩니다. 확인 된 인 산화 사이트가 올바른 경우, 해당 phosphonegative 돌연변이 phosphorylated 체 외수 없습니다.

성공적인 인 산화는 표적 단백질의 검출 하는 간단한 도구가입니다 여기에 설명 된 간단한 SDS 페이지 젤 교대 분석. Phosphorylated 단백질은 일반적으로 느리게 SDS 페이지에 추가 크기와 음 전 unphosphorylated 들 보다 마이그레이션합니다. Note는 큰 단백질에 대 한 SDS 페이지 분석의 최적화 하는 데 필요한 시각화 젤 교대를 충분히 해상도 향상. 유용한 도구 phosphorylated 단백질의 특정 분리에 대 한 인산 염-바인딩 태그 (태그 포스) SDS 페이지. Phosphorylated 단백질 젤 포스 태그 아크릴 준비에 해당에 비해 느린 마이그레이션 밴드 dephosphorylated 단백질50,51으로 시각화 됩니다.

높은 품질 질량 스펙트럼을 얻기 위해 생체 외에서 니 분석 결과 대 한 단백질은 순수 하 고 균질 매우 중요 하다. 우리의 정화 프로토콜 몇 가지 매우 선택적 크로마토그래피 단계를 결합 하 여 고 단백질 저하 고 protease 억제제 및 reductants의 추가 통해 산화를 방지 하 여이 달성 한다. 정화 프로토콜 (, GST-태그 그대로); 티로 단백질을 elute를 수정할 수 있습니다. 그러나, 그것은 GST-태그 추가 다른 25 kDa, 및 큰 단백질 질량 분석에 대 한 목표 도전 고려 되어야 한다. 또는, 그의6에 대 한 우리의 정화 프로토콜-태그 융해 단백질을 사용할 수 있습니다.

이 프로토콜은 또한 다른 kinases에 관련 된 인 산화 사이트 식별 수정할 수 있습니다. 유일한 요구 사항은 정화 니 사용할 수 있는, 적극적인, 그리고 충분히 안정적입니다. 시험 조건을 최대 활동을 달성 하기 위해 각 키에 대 한 조정 될 필요가 있다. 매개 변수를 최적화 하는 키 니 아 제, 반응 버퍼 (pH, 염 농도), 보육 시간, 반응 온도, 및 ATP 농도의 양을 포함 합니다. 키 니 아 제 분석 실험 체 외에 성공적으로 사용 되었습니다 많은 등 Plks (폴로 같은 kinases)52,,5354, kinases와 MAPK/ERK kinases (물질 활성화 단백질 인 산화 사이트 식별 kinases extracellular 신호 통제 / kinases)55,56.

이 방법의 강도 순화 된 단백질의 인 산화 특정 사이트를 식별 하는, Cdk1 체 외 를 인 산화 사이트 반드시 phosphorylated 비보되지 않을 수 있습니다 주목 해야한다. 비비 안에o, 추가적인 규제 메커니즘 장소, 인 산화 사이트 Cdk1에 의해 인식에 대 한 액세스할 수 없게 렌더링 수 있습니다. 예를 들어 추가 상호 파트너 존재 vivo에서, 수 인 산화 사이트를 은폐 하거나 구조 변화를 통해 액세스할 수 있도록 수 있습니다. 또한, 기판 phosphorylated 될 위해서는 G2 단계에서 핵에 있는 Cdk1/ b colocalize 필요 합니다. 또한, 포스트 번역 상 수정 또는 다른 규제 프로세스 수 영향을 대상 단백질에 vivo에서, 인 산화 사이트를 액세스할 수 없는 렌더링할 수 있는 구조. 셀 또는 확인 된 인 산화 사이트 생리 기능 확인 동물 모델에서 적절 한 실험을 설계 하 여 이러한 한계를 극복할 수 있습니다. 여기, 우리 기능 검증에 대 한 간단한 바인딩 분석 결과 사용 하 여, karyopherin α. 기능 검증 CENP F의 상호 셀 컨텍스트 또는 동물 모델에서 수행도 인 산화 감소 때문. 따라서, 우리는 또한 헬러 세포10에 cNLS를 포함 하는 CENP-F-파편의 형광 성 융해 단백질 페. Phosphomimetic 돌연변이 cNLS에서 CENP-F의 핵 지역화, 확인이 인 산화 사이트10의 생리 기능 저하.

몇 가지 도구 기능 검증 인 산화 위치의 셀 또는 동물 모델에서 사용할 수 있습니다. 음 전 여 인 산화의 효과 모방, Phosphomimetic 돌연변이이 목적을 위해 널리 이용 된다. 이들을 위해, 인 산화 사이트 (떠들고 또는 트레오닌) aspartate 또는 조미료로 대체 됩니다. 이점은 대상 단백질의 돌연변이 포인트 필요 하다는 것 이다. 그것은 지적 한다, 그 동안 phosphomimetic 돌연변이 기능 검증에 대 한 많은 경우에 성공적으로 사용 했다, 그들은 특히 작동 경우 요금 변경이 구조적 변화 보다는 규제에 대 한 주된 기여는 어디에. Phosphomimetic 돌연변이 (예를 들어, 11) 많은 경우에 인 산화의 효과 모방 하기 위해 실패 합니다. 그러나, 다른 접근 phosphonegative 돌연변이의 사용을 포함 하 여 인 산화 위치의 기능 확인을 위해 사용할 수 있습니다:이 돌연변이 알라닌과 인 산화 사이트를 대체 하 여 인 산화를 방지. 세포질 컨텍스트에서 기능 검증을 위한 또 다른 유용한 방법은 소개 지점 돌연변이 (D146N)47,,4849에 의해 활동 되지 않 ㄴ Cdk1의 키-죽은 돌연변이의 표현 이다. 특히, 여러 작은 분자 Cdk1 억제제로-3306, 셀 또는 동물 모델7,,811기능 연구에 사용 될 수 있는 Flavopiridol 등 상업적으로 사용할 수 있습니다. 이 억제제 잘 특징이 있으며 (리뷰 참조9)에 대 한 암 치료에 대 한 임상 실험에는.

동안 많은 수의 단백질 인 산화 사이트 proteomic 연구에 확인 되었습니다, 키 니 아 제 특이성 알 수 없는, 대부분의 경우 이며 생체 외에서 니 분석 결과 Cdk1의 기질을 식별 하기 위해 사용할 수 있는 몇 가지 방법 중 하나입니다. 다른 접근 방식 또한 사용 되었습니다. Cdk1 대상 설계 Cdk1 효소를 사용 하 여 확인 되었다. 그것은 큰 기판 바인딩 주머니는 고 기판6으로 ATP의 더 큰 버전을 허용. 이 대형 기판 야생-타입 kinases 바인딩할 수 없습니다. 셀 방사선된 부피가 ATP의 추가 추출 수정된 Cdk1 효소는 그러므로 Cdk1. 직접 기판의 특정 라벨에 리드를 포함 200 Cdk1 목표는 신진 효 모에이 방법; 확인 되었다 그러나, 그것은 적용할 수 없습니다 포유류 세포에 중요 한 제한입니다. 또 다른 연구에서는 Cdk1 기판은 Cdk1, Flavopiridol, 및 RO-3306 두 작은 분자 억제제를 사용 하 여 양적 phosphoproteomics 분석을 수행 하 여 인간의 조직 배양 세포에서 발견 됐다. 551 단백질에 1215 phosphopeptides Cdk1 억제제 추가7시 크게 감소 되었다. 이 방법은 잠재적인 Cdk1 대상에 대 한 전체 프로테옴 화면 수 있습니다 있지만 결과 확인할 필요가 목표, 예를 들면, 생체 외에서 키에 의해 분석 결과.

미래에 생체 외에서 니 분석 결과 가능성이 높은 처리량에 현재 개발 중인 Cdk1 기판에 대 한 화면으로 결합 됩니다. 프로테옴의 Cdk1 기판의 많은 수 때문 많은 인간 Cdk1 기판 확인할 수를 유지 하 고 생체 외에서 니 분석 결과 식별, 지도, 및 이러한 사이트를 확인 하는 중요 한 도구가 될 것입니다.

생체 외에서 니 분석 결과 키 Cdk1에 대 한 목표를 식별 하 고 인 산화 특정 사이트를 식별 하는 강력한 도구 이다. 이 인 산화 위치의 식별 기계 연구를 Cdk1에 의해 세포질 과정의 규칙에 대 한 수 있습니다.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

저자는 공개 없다.

Acknowledgments

우리는 질량 분석 분석 및 유용한 의견에 대 한 박사 데이비드 킹, 하 워드 휴즈 의학 연구소, 캘리포니아 대학 버클리를 감사합니다. 우리는 박사 Xuelian 주, 상하이, 생물 과학을 위한 학회, 과학의 중국 아카데미, 상하이, 중국 전체 길이 CENP F 구조를 제공 하기 위한 감사 합니다. 마지막으로, 우리는 감사 박사 수잔 베인 박사 브라이언 칼라, 빙 엄 턴 대학에서 박사 Christof Grewer 장비에 대 한 액세스. 이 연구는 뉴욕의 주립 대학 및 대학의 뉴욕 주립 빙햄 턴 화학과 연구 재단에 의해 투자 되었다.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
 종속 키 1의 <em>시험관에서</em> 키에 의해 인 산화 특정 사이트 분석 결과
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter