Login processing...

Trial ends in Request Full Access Tell Your Colleague About Jove
Click here for the English version

Biochemistry

Identifiering av cyklin-beroende Kinase 1 särskilda fosforylering platser av ett In Vitro -Kinas Assay

doi: 10.3791/57674 Published: May 3, 2018
* These authors contributed equally

Summary

Cyklin-beroende kinase 1 (Cdk1) aktiveras i den G2-fasen i cellcykeln och reglerar många cellulära vägar. Här presenterar vi ett protokoll för en in vitro- Kinas analys med Cdk1, som möjliggör identifiering av Cdk1-specifika fosforylering platser för fastställande av cellulära mål denna viktigt-Kinas.

Abstract

Cyklin-beroende kinase 1 (Cdk1) är en master controller för cellcykeln i alla eukaryota organismer och phosphorylates uppskattningsvis 8-13% av proteomet; antalet fastställda mål för Cdk1, särskilt i mänskliga celler är dock fortfarande låg. Identifiering av Cdk1-specifika fosforylering platser är viktigt, eftersom de ger mekanistiska insikter i hur Cdk1 styr cellcykeln. Cellcykelns reglering är kritiska för trogna kromosomsegregering och defekter i denna komplicerade process leda till kromosomavvikelser och cancer.

Här beskriver vi en in vitro- Kinas analysmetod som används för att identifiera Cdk1-specifika fosforylering platser. I denna analys, är ett renat protein fosforyleras i vitro av kommersiellt tillgängliga mänskliga Cdk1/cyklin B. framgångsrika fosforylering bekräftas av SDS-PAGE, och fosforylering platser identifieras därefter med masspektrometri. Vi beskriver också rening protokoll som ger mycket ren och homogen protein preparat passar kinase analysen, och en bindande analys för funktionell kontroll av de identifiera fosforylering webbplatser, som sonder samspelet mellan en klassisk cellkärnelokalisering signal (cNLS) och dess nukleära transporter receptor karyopherin α. För att underlätta med experimentell design, granskar vi metoder för förutsägelse av Cdk1-specifika fosforylering platser från proteinsekvenser. Tillsammans ger dessa protokoll en mycket kraftfull metod som ger Cdk1-specifika fosforylering platser och möjliggör mekanistiska studier i hur Cdk1 styr cellcykeln. Eftersom denna metod förlitar sig på renade proteiner, kan det tillämpas på modellen organism och avkastning tillförlitliga resultat, särskilt i kombination med cell funktionella studier.

Introduction

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Kinaser är enzymer som transfererar fosfat från ATP på substrat och reglerar många cellulära processer. Detta fosforylering är reversibel, snabb, lägger två negativa laddningar, och lagrar fri energi och är en av de vanligaste posttranslationell ändringar används av celler. Cdk1, som också kallas cell division cycle protein 2 homolog (cdc2) är en master controller för cellcykeln i alla eukaryota organismer1,2,3,4,5, och phosphorylates en uppskattningsvis 8-13% av proteomet6,7.

Medan nyare proteomiska studier har identifierat många fosforylering platser i proteiner, i de flesta fall, är tyrosinkinashämmare som är ansvarig för dessa ändringar okänd. Antalet kända Cdk1 mål, särskilt i mänskliga celler är låg7. Identifiering av Cdk1-specifika fosforylering platser är viktigt, eftersom det möjliggör mekanistiska studier som fastställer hur Cdk1 styr cellcykeln. Cellcykelns reglering är viktigt för trogna kromosomsegregering och celldelningen, och en myriad av cellulära processer måste ske för att stödja denna viktiga fysiologiska funktion. Detta inkluderar att stoppa transkription och translation före uppkomsten av Mitos, liksom en dramatisk omorganisation i cellstruktur och organisation, till exempel demontering av kärn kuvert, kromosom kondens och mitotiska spindelenhet. Avreglering och fel i dessa processer orsaka cancer, fosterskador eller mitotiska celldöd. Hämmare av Cdk1 såsom RO-3306 var utvecklade8, som ger kraftfulla verktyg för funktionella studier, och några av dessa hämmare är för närvarande i kliniska prövningar för behandling av cancer (se9 för granskning).

Här beskriver vi en in vitro- Kinas analysmetod som möjliggör identifiering av Cdk1-specifika fosforylering platser. I denna analys används kommersiellt tillgängliga mänskliga Cdk1/cyklin B att fosforylera en renad mål protein i vitro. Fosforylering av substrat ökar dess massa och lägger till två negativa laddningar; Därför bekräftas framgångsrika fosforylering av en uppåtvinkling protein gel bandet på SDS-PAGE. Cdk1-specifika fosforylering platser identifieras senare av masspektrometri analys av proteinet i vitro fosforyleras. För att underlätta med experimentell design, granskar vi även beräkningsverktyg och referenser för förutsägelse av Cdk1-specifika fosforylering platser från proteinsekvens. Dessutom beskriver vi också rening protokoll som ger mycket ren och homogen protein preparat lämplig för Kinas analysen. Slutligen de identifiera fosforylering webbplatserna måste kontrolleras av funktionella studier, och en enkel bindning analys beskrivs här för ändamålet. Kombinerat, är detta en mycket kraftfull metod som ger Cdk1-specifika fosforylering platser och möjliggör mekanistiska studier i hur Cdk1 styr cellcykeln7,10,11. Eftersom denna metod förlitar sig på renade proteiner, kan det tillämpas på någon modell organismen och ger tillförlitliga resultat. Men funktionell kontroll av den erhållna fosforylering platser i vitro rekommenderas, eftersom cellerna har ytterligare reglerande mekanismer på plats, såsom posttranslationell modifieringar, interaktion partner eller cellulär lokalisering som kan göra fosforylering platser tillgängliga eller otillgängliga för erkännande av Cdk1.

Cdk1 erkänner en konsensus fosforylering webbplats som består av (Ser/Thr-Pro-X-Lys/Arg), där X är alla rester och en serin eller treonin är platsen för fosforylering. Särskilt viktigt för erkännande är förekomsten av prolin i + 1 position. Dessutom grundläggande rester är att föredra i + 2 eller + 3 positioner, med de flesta Cdk1-specifika fosforylering webbplatser som innehåller en Lys eller Arg på de + 3 position6,12.

Aktivering av Cdk1 är hårt reglerad och leder till uppkomsten av Mitos1,2,3,4,5. Aktiviteten av cyklin-beroende kinaser beror i allmänhet på deras förening med distinkta cyclins (cyklin A, B, C, D, och E hos människor), som uttrycks på svängande nivåer i hela cellcykeln13. Cdk1 uttryck är konstant över cellcykeln och regleringen av dess aktivitet är beroende av dess förening med föreskrivande subunitsna cyklin A och cyklin B5,13,14,15, som samt post-translationella modifieringar. Bildandet av Cdk1/cyklin B-komplex krävs för Kinas aktivering5,14,15,16,17,18. I den G2-fasen, är cyklin B översatt i cytosolen och importeras in i cellkärnan där det binder till Cdk15,14,15,16,17,18. dock hålls Cdk1/cyklin B inaktiverade genom fosforylering på rester Thr14 och Tyr15 av de mänskliga Cdk1-hämmande kinaser Myt1 (membran-associerade tyrosin - och treonin-specifika cdc2-hämmande kinase) och Wee1, respektive19, 20,21. I den sena G2-fasen, Defosforylering av Thr14 och Tyr15 av celldelning cykel 25 fosfatas (cdc25) aktiverar kinase aktiviteten av Cdk1/cyklin B-komplex och utlöser inledandet av Mitos12,14, 18 , 20 , 22 , 23. fosforylering av Thr161 krävs också för Cdk1/cyklin B aktivering och medieras av Cdk7, Cdk-aktiverande kinase (CAK)18. Nedbrytning av cyklin B i Anaphasen inactivates Cdk1, så att utloppet från Mitos24,25. Aktivering av Cdk1/cyklin B är därför en komplicerad process. Det protokoll som presenteras här utförs med kommersiellt tillgängliga Cdk1/cyklin B. Under rekombinant uttryck för detta komplex i insekt celler, det är aktiverat i vivo av endogena kinaser14,20 och förblir aktiv i tillståndet renat. Den resulterande aktiv, rekombinant humant Cdk1/cyklin B är lämplig för in vitro- Kinas analyser.

Här beskriver vi ett protokoll för identifiering av Cdk1-specifika fosforylering platser i mänskliga centromer protein F (CENP-F)10. CENP-F är en Kinetochor protein som finns i kärnan under större delen av interphase (G1 och S-fas) och exporteras till cytosolen i G2 fas26,27,28 Cdk1-beroende sätt10, 11. cellkärnelokalisering ges av en bipartit cNLS26. cNLSs känns igen av den nukleära transporter faktor karyopherin α, vilket underlättar, tillsammans med karyopherin β och RanGDP, import av cNLS-Last till nucleus29. Kärnteknisk export i fasen G2 underlättas via en okänd export väg10. När CENP-F finns i cytosolen, det rekryteras att kärn kuvertet och i sin tur rekryterar de motoriska protein komplexa dynein30,31. Denna väg är viktigt att placera kärnan respektive till centrosome under inledningsskedet av mitotiska spindelenhet i ett dynein dosberoende sätt, vilket är viktigt för den rätta tidpunkten för mitotiska inträde och för en grundläggande process i hjärnan utveckling30,31,32. Start i den G2-fasen, monteras CENP-F också i Kinetochor där det har viktiga roller för trogna kromosom segregation27,28,33,34,35 . En viktig reglerande steg av dessa vägar är kärnteknisk export av CENP-F i den G2-fasen, som är beroende av Cdk110,11. Vi beskriver här ett protokoll för identifiering av Cdk1-specifika fosforylering platser i cNLS CENP-f. Phosphomimetic mutationer i dessa platser sakta ner nukleära import av CENP-F, vilket tyder på att Cdk1/cyklin B direkt reglerar cellulär lokalisering av CENP-F genom fosforylering av dess cNLS10.

Sammantaget möjliggör denna in vitro- Kinas analys identifiering av specifika substrat för Kinas Cdk1. renat mål proteinerna är fosforylerade in vitro- av kommersiellt tillgängliga Cdk1/cyklin B-komplex och fosforylering webbplatser är därefter identifierade genom masspektrometri. Identifiering av Cdk1-specifika fosforylering platser stöder mekanistiska studier som avslöjar hur Cdk1 styr cellcykeln.

Subscription Required. Please recommend JoVE to your librarian.

Protocol

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

1. förutsägelse av Cdk1-specifika fosforylering platser från proteinsekvens

  1. Innan du börjar Kinas analysen, analysera protein sekvensen för förutsedda Cdk1-specifika fosforylering webbplatser och Sök litteraturen för experimentellt fastställda fosforylering platser med okänd kinase specificitet. Använd följande verktyg, databaser och referenser som resumeras.
    1. Använda de iGPS 3.0 programvara36,37 (http://gps.biocuckoo.org/online_full.php) för att förutsäga Cdk1-specifika fosforylering platser i sekvensen mål protein. Använd länken här för en omfattande förutsägelse som innehåller anteckningar sekundärt strukturera och ytans tillgänglighet.
    2. Ange sekvensen protein i FASTA format i programvaran. Kontrollera CMGC, CDC2, CDK, serin/treonin-Kinas, CDK1för Kinas specificitet, och avmarkera alla andra särdrag. Välj medium som tröskelvärde och klicka på Skicka -knappen.
    3. Jämföra de resulterande förväntade platserna med webbplatsen Cdk1 samförstånd fosforylering (Ser/Thr-Pro-X-Lys/Arg).
    4. Viktigast av allt, kontrollera webbplatsen förutspådde för prolin bredvid fosforyleras återstoden (vissa Cdk1 substrat är fosforyleras en minimal plats (Ser/Thr-Pro)6,12). Kontrollera dessutom för grundläggande restprodukter, som är att föredra i + 2 eller + 3 positioner, med de flesta Cdk1-specifika fosforylering webbplatser som innehåller en Lys eller Arg på + 3 position6,12.
  2. Kontrollera även att webbplatsen är tillgänglig för erkännande, eftersom förekomsten av en full enighet webbplats inte är tillräckligt för Cdk1 fosforylering.
    1. Inspektera ytan tillgänglighet och sekundärt strukturera förutsägelse anteckning i iGPS utdata, där det står om webbplatsen spås bli tillgänglig; N - och C-termini av proteiner är i många fall flexibla och tillgängliga för fosforylering.
    2. Om en röntgen struktur målproteinet är tillgänglig, kontrollera tillgänglighet av förmodad fosforylering platser genom att inspektera deras plats i strukturen.
  3. Sök litteraturen för experimentellt fastställda fosforylering platser med okänd kinase specificitet med hjälp av UniProtKB/Swiss-Prot databas38 (http://www.uniprot.org).
    1. Ange namnet på proteinet i sökrutan och klicka på knappen Sök . Välj posten rätt sekvens. Fosforylering platser är kommenterade och refereras i avsnittet aminosyra ändringar .
    2. Sök för proteomik studier av mitotiska extrakt av mänsklig cell linjer7,39,40, vilket är särskilt användbart eftersom Cdk1 blir aktiv i den G2-fasen i cellcykeln.
  4. Identifiera bipartit cNLS av NLSmapper (tillval).
    Obs: För proteiner som transferservice mellan cytosolen och kärnan, en gemensam mekanism för reglering av cellulära lokalisering är fosforyleringen av en bipartit cNLS i-1 position av större motiv av Cdk1. Fosforyleringen avskaffar cellkärnelokalisering i G2 fas10,41,42,43.
    1. För sådana shuttling proteiner, identifiera cNLS i sekvensen protein genom NLSmapper43 (http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Klistra in protein sekvensen som text i rutan sekvens, Välj en cut-off poäng av 5.0 och välja att söka efter Lantmäteriverket i hela regionen. Klicka på knappen Förutsäga NLS .
    2. Jämföra den resulterande förutspådda cNLS mot konsensus sekvensen av en bipartit cNLS, som består av mindre motivet (Lys-Arg), en länkare av minst 10 rester och större motivet (Lys-Lys/Arg-X-Lys/Arg), där X är alla rester som inte debiteras negativt .
    3. Kontrollera om den förutsedda Cdk1 fosforylering webbplatsen (*) ligger intill det stora motivet i länkaren-1 position: Ser/Thr*-Pro/X-X-Lys-Lys/Arg-X-Lys/Arg.
      Obs: Fosforyleringen av en bipartit cNLS i-1 position av Cdk1 etablerades som en reglerande mekanism för cellulär lokalisering för flera shuttling proteiner10,41,42, 43.

2. redovisning av rekombinanta proteiner i Escherichia Coli

  1. Använda uttrycket plasmidsna från steg 2.1.1-2.1.2 för uttrycket av rekombinanta proteiner i E. coli.
    1. För att skapa den mänskliga CENP-F (2,987-3 065 rester) uttryck konstruera, generera skär genom att förstärka DNA-fragment av polymeras-kedjereaktion (PCR) från en fullängds CENP-F-konstruktion (GenBank anslutning: U19769.1). Använd följande grundfärger: AGTCGGGGATCCCAGCAATCTAAACAAGATTCCCG och AGTCGGCTCGAGTCATTATTCTGCAGGGTGAATACCACTCATG.
      Obs: Fullängds mänskliga CENP-F plasmiden lämnades generöst av Dr. X. Zhu, institut för biologiska vetenskaper, kinesiska vetenskapsakademin, Shanghai, Kina.
      1. Klona skäret till pGEX6p1 vektorn med BamHI och XhoI begränsning webbplatser. Använda denna plasmid för att uttrycka N-terminala glutation S-transferas (GST) fusionsproteinerna CENP-f (2,987-3 065 rester).
        Obs: GST-etiketten kan vara klyvs bort av den PreScission proteashämmare (hädanefter kallad PS proteashämmare).
    2. För den mänskliga karyopherin α uttryck konstruera, generera skär genom att förstärka DNA-fragment med PCR från en fullängds karyopherin α2 cDNA mall (sekvens anslutning NM_002264.3; grundfärger: GCACTACATATGTCCACCAACGAGAATGCTAATA och TCACGCCTCGAGTTATCAAAAGTTAAAGGTCCCAGGAGCC).
      Obs: På grund av likheten mellan isoformerna, denna karyopherin α2 konstruktion benämns i den efterföljande texten karyopherin α.
      1. Klona skäret till pET28a-pres vektorn med NdeI och XhoI begränsning webbplatser.
        Obs: Detta är en modifierad pET28a vektor som sekvens kodning för webbplatsen trombin klyvning ersattes av en sekvens som kodar för en PS proteas klyvning webbplats. Använd denna plasmid för att uttrycka ett fusionsprotein av karyopherin α med en N-terminal hans6-tagg, där den hans6-tagg kan vara klyvs bort av PS proteashämmare.
  2. För att skapa punktmutationer av ett målprotein, utföra webbplats riktad mutagenes med ett kit.
  3. Uttrycka de rekombinanta proteinerna i E. coli för efterföljande rening.
    1. Göra följande bestånd: 50 mg/mL kanamycin (1:1, 000 stamlösning), 35 mg/mL kloramfenikol i 70% etanol (1:1, 000), 100 mg/mL ampicillin (1:1, 000), och 1 M isopropyl β-D-1-thiogalactopyranoside (IPTG; 1:5, 000).
    2. Sterila filtrera bestånden och förvaras vid-20 ° C. Undvik upprepad frysning-tining cykler för IPTG.
    3. Förvandla 1 µL uttryck plasmid till 50 µL av behöriga celler av E. coli Rosetta 2 (DE3) pLysS stam, enligt tillverkarens instruktioner.
    4. Tallrik kulturen på Luria-Bertani (LB) agar med kloramfenikol (35 µg/mL LB) och ampicillin (100 µg/mL LB) för CENP-F konstruera, eller kloramfenikol och kanamycin (50 µg/mL kultur) för den karyopherin α konstruktion. Inkubera plattorna för 12-20 h vid 37 ° C.
    5. Plocka en enda koloni och Inokulera 50 mL LB kompletteras med antibiotika (se steg 2.3.4). Inkubera i preculture under omskakning vid 160-180 rpm för 12-20 h vid 37 ° C.
    6. Förbereda 1 L lb medium i en 2 800 mL snopen Fernbach kolv. Göra två kolvar för varje preculture och autoklavera dem. För att möjliggöra luftning, Fyll inte kolvar till mer än två tredjedelar mätkolv volym. Erlenmeyer-kolvar kan användas också.
    7. Lägga till antibiotika (steg 2.3.4) och 10 mL av en steril-filtrerad 40% (w/v) glukoslösning per 1 L kylt LB. Tillsätt 20 ml preculture per 1 L LB medium.
      Obs: Absorbansen vid 600 nm i en 1:10 utspädning av preculture bör vara mellan 0,15-0,2.
    8. Inkubera kolvar under omskakning vid 160-180 rpm vid 37 ° C. Mät absorbansen vid 600 nm av bakterier kultur regelbundet. Om absorbansen når 0.5-0.6, framkalla proteinuttryck genom att lägga till 0,2 mM IPTG (200 µL av 1 M lager per 1 L LB medium).
      Obs: Det är viktigt att cellerna induceras vid rätt absorbansen. Det tar vanligtvis 3-4 h att nå detta stadium.
    9. Inkubera kolvar under omskakning för 3 h vid 37 ° C. Skörda cellerna genom centrifugering (15 min, 4 100 x g, 4 ° C, swing-out rotor). Kassera supernatanten. Återsuspendera cell pellets i 20 mL GST-bindande buffert (CENP-F) eller hans6-bindande buffert (karyopherin α) per 1 L av kultur. Lagra cellerna vid-80 ° C.
      1. Förbereda GST-bindande bufferten (10 mM Tris pH 8,0 vid 25 ° C, 150 mM NaCl, 1 mM Ditiotreitol (DTT), 0,5 mM EDTA) och hans6-bindande buffert (10 mM Tris pH 8,0 vid 25 ° C, 250 mM NaCl, 5 mM Imidazol pH 8,0, 5 mM β-merkaptoetanol (BME)) i förväg.

3. rening av rekombinant Protein av glutation-affinitetskromatografi och gelfiltrering

  1. Göra följande bestånd: 1 M DTT (1:1, 000 lager, sterila filtreras med 0,2 µM porstorlek och avgasas); 250 mM phenylmethylsulfonyl fluor (PMSF; 1:1,000 lager i dimetylsulfoxid). Förvaras vid-20 ° C. Undvik upprepad frysning-tining cykler.
  2. Göra följande buffertar och kyl dem till 4 ° C.
    1. Förbereda GST-bindande buffert med 10 mM Tris pH 8,0 vid 25 ° C, 150 mM NaCl, 1 mM DTT, 0,5 mM EDTA.
    2. Förbereda GST-eluering buffert med 10 mM reducerad glutation (0,15 g/50 mL) upplöst i en buffert på 50 mM Tris pH 8,0 vid 25 ° C, 150 mM NaCl, 1 mM DTT. Bekräfta att den slutliga buffert pH är 8.0 och använda den samma dag som det gjordes.
    3. Förbereda gelfiltrering buffert med 20 mM Tris pH 7.5 vid 25 ° C, 60 mM NaCl, 2 mM DTT. Sterila filter bufferten med en flaska-topp-filter (0,2 µM porstorlek). Degas bufferten under omrörning under vakuum (-6 psi) för 15 min.
    4. Lägga till DTT alla ovan buffertar på dagen för användning.
  3. Tina de celler från avsnitt 2 som innehåller den CENP-F konstruktion. Justera volymen till 40 mL med GST-bindande bufferten. Lägg till 1 mM DTT, 0,25 mM PMSF, 0,5 mM EDTA (0,5 M stamlösning, pH 8,0), 7 mg benzamidinen hydroklorid (1 mM) och 40 mg D/L metionin.
    Obs: För att minska proteolytisk nedbrytning, utföra alla steg vid 4 ° C, helst i ett kallt rum, om inget annat anges. Hålla celler, lysates och renat protein bråk på isen hela tiden och tillsätt proteashämmare. För att förhindra oxidation av cystein och metionin rester, lägga till reduktionsmedel såsom DTT och metionin under experimentet. För att minska proteolytisk nedbrytning, arbeta igenom steg snabbt.
  4. Lyse celler i en någon sonikator som följer. Fyll en glasbägare med den lysate och fördjupa det i ett vattenbad på isen. Sonikera kulturen (1 min 40 s, på 100 W (50%) output/amplitud, med 10 s pulser och 10 s vila cykler). Lägga till 250 µM PMSF efter ultraljudsbehandling. Inspektera den cell lysate, som bör se mer transparent och inte längre vara trögflytande.
  5. Klart den lysate genom centrifugering på 12 000-40 000 x g, 25 min, 4 ° C. Använda runda-botten centrifugrör och en fast vinkel rotor.
  6. Utföra Jämviktstiden genom att lägga till 2 mL av glutation agaros 1:1 slam till en disponibel kromatografi kolumn. Den resulterande kolumnen har en volym om 1 mL. Tvätta kolonnen med 25 mL av ultrarent vatten och 25 mL av GST-bindande buffert.
  7. Utföra bindande enligt följande. Arbetar i ett kallt rum eller kall låda, Dekantera den lysate från pellets. Filtrera den lysate (0,2 µm porstorleken) och häll det på kolumnen ansluten. Cap kolumnen och inkubera det samtidigt försiktigt nutating under 30 minuter vid 4 ° C.
  8. Tvätta kolonnen, lägga den på ett galler, låt kådan kvitta och samla in flödet genom. Tvätta kolonnen två gånger med 25 mL av GST-bindande buffert.
  9. Eluera genom proteolytisk klyvning.
    1. Anslut kolumnen. Lägga till 400 µL av GST-bindande buffert och 250 µL av PS proteas (2 mg/mL lager med en aktivitet av 1000 U/mg, antingen renas i labbet eller köpt, se Tabell för material).
    2. Cap kolumnen och snurra försiktigt för att resuspendera kådan i bufferten. Inkubera kolumnerna för 16-20 h vid 4 ° C. Lägg sedan till 4 mL GST-bindande buffert till eluera proteolytically klyvs CENP-F fragmentet från kolumnen.
  10. Glutation eluering
    1. Anslut kolumnen, tillsätt 4 mL GST-eluering buffert (4 kolumn volymer) och inkubera i 10 min till eluera bundna GST-etiketten. Samla eluatet. Regenerera kolumnerna innan återanvändning som beskrivs av tillverkaren.
  11. Analysera PS proteas eluering fraktionen och den glutation eluering fraktionen av SDS-PAGE på 16% akrylamid geler. Utför elektrofores vid 25 V/cm för 45 min. fläcken gelerna av Coomassie blå. PS proteas fraktionen innehåller renade CENP-F fragmentet, glutation fraktionen kommer att innehålla den klyvs GST-tag. Inspektera gelen för att bedöma proteolytisk klyvning effektivitet.
  12. Koncentrera sig PS proteas eluatet till 0,5 mL med centrifugal filterenheter med en 3 kDa molekylvikt cutoff (se Tabell för material). Lägg eluatet i övre facket av filtret och centrifugera det i steg om 10-15 min vid 4.100 x g, 4 ° C (swing-out rotor) att koncentrera provet. Blanda genom pipettering efter varje ökning.
  13. Anslut en lämplig gel filtrering kolumn (se Tabell av material för inköpsinformation) till ett snabbt protein vätskekromatografi (FPLC) system, och temperera den med 1 kolumn volym gel filtrering buffert.
  14. Centrifugera koncentrerad CENP-F fragmentet i en mikrocentrifug (20 min, 21,700 x g, 4 ° C). Injicera provet på kolumnen och eluera det med 1 kolumn volym gel filtrering buffert. Samla in 0,6 mL fraktioner.
    Obs: Gel filtrering bufferten är optimerad för kompatibilitet med efterföljande kinase analys. Testa om målproteinet är stabilt i denna buffert. Om det inte är stabil, prova att lägga mer natriumklorid.
  15. Analysera peak fraktioner av SDS-PAGE (steg 3.11). Poolen peak fraktioner som innehåller ren CENP-F fragment. Koncentrera sig renad CENP-F fragment till 3,3 mg/mL (steg 3.12). Analysera de rena CENP-F fragment av SDS-PAGE (steg 3.11).
  16. Protein koncentration bestämning
    1. Späd den prov 1: 100 i ultrarent vatten och placera den i en kvarts mikro-kyvetten. Spela in spectra på ett våglängdsområde 220-300 nm i en spektrofotometer.
      Obs: Protein koncentrationen c (mg/mL) härleds från följande ekvation:
      Equation
  17. Gör 50 µL alikvoter av renat protein i 0,5 mL mikrorör och flash-frysa dem i flytande kväve. Lagra alikvoter vid-80 ° C.

4. rening av rekombinant Protein av Ni-NTA affinitetskromatografi

  1. Göra följande buffertar och kyl ned till 4 ° C.
    1. Förbereda den hans6-bindande buffert med 10 mM Tris pH 8,0 vid 25 ° C, 250 mM NaCl, 5 mM Imidazol pH 8,0, 5 mM BME. Lägga till BME alla buffertar på dagen för användning.
    2. Förbereda den hans6-tvättbuffert på samma sätt som hans6-bindande buffert men med 20 mM Imidazol.
    3. Förbereda den hans6-eluering buffert på samma sätt som bindande bufferten men med 150 mM Imidazol.
  2. Tina upp cellerna från avsnitt 2 som innehåller de karyopherin α konstruera och justera volymen till 40 mL med hans6 -bindande buffert. Lägg till 5 mM BME, 0.250 mM PMSF, 7 mg benzamidinen hydroklorid (1 mM) och 40 mg D/L metionin.
    1. Fortsätt enligt beskrivningen i steg 3,4-3,8 med följande variationer: använda hans6-bindande buffert istället för GST-bindande buffert för alla steg. I stället för glutation agaros, Använd 4 mL av Nickel affinitet gel (se Tabell för material) för att göra den kolumn som kommer att ha en kolumn volym av 2 mL.
      Obs: Nickel affinitet kolumner är oförenliga med DTT och EDTA. Istället för Nickel affinitet gelen, Ni2 +- nitrilotriacetic syra (NTA) agaros kan användas, om koncentrationen av Imidazol i eluering bufferten höjs till 250 mM (se Tabell för material).
  3. Tvätta den kolumner med 8 mL av hans6-tvättbuffert.
  4. Elute den karyopherin α med 12 mL av hans6-eluering buffert och analysera eluatet med SDS-PAGE (steg 3.11).
  5. Lägga till 250 µL av PS proteas (steg 3.9) till eluatet och inkubera i 16-20 h vid 4 ° C. Under tiden dialyze eluatet två gånger mot 1 L av hans6-bindande buffert för 2-20 h, med en dialys membran med en 6-8 kDa molekylvikt cutoff.
  6. Regenerera kolumnen Nickel affinitet gel som beskrivs av tillverkaren. Jämvikta kolonnen med 25 mL av hans6-bindande buffert. Lägga till det dialyzed proteinet till kolumnen och utföra det bindande steg som beskrivs i steg 3,7.
  7. Samla in flödet genom, som innehåller den renade karyopherin α (med hans6-taggen klyvs bort), och eluera återstående proteinet med ytterligare 4 mL av hans6-bindande buffert. Poolen dessa fraktioner. Sedan eluera kolonnerna med 12 mL av hans6-eluering buffert. Denna fraktion innehåller föroreningar.
  8. Analysera uncleaved och klyvs karyopherin α från trappan 4.4-4.5 och två eluering fraktioner från detta steg av SDS-PAGE (steg 3.11) att utvärdera effektiviteten i hans6-tagga klyvning och renhet.
  9. Koncentrera sig på karyopherin α till 8 mg/mL och flash-frysa i flytande kväve (steg 3.15-3.17).

5. in Vitro -Kinas Assay med Cdk1/cyklin B

  1. In vitro -Kinas assay
    Obs: Vid ankomsten av kinase, göra små delprover, flash-frysa dem i flytande kväve och lagra dem vid-80 ° C. Använd inom 6 månader. Molekylvikten är 34 kDa för Cdk1 och 48 kDa för cyklin B, är cyklin B på SDS-PAGE uppenbara molekylvikt ca 60 kDa.
    1. Förbereda 10 x PK buffert (levereras med kinase) med 0,5 M Tris-HCl, 0,1 M MgCl2, 1 mM EDTA, 20 mM DTT, 0.1% Brij 35, pH 7.5 vid 25 ° C.
    2. Förbereda 10 x ATP lager: gör en lösning av 4 mM ATP 1 x PK buffert och kontrollera slutligt pH av beståndet. Förvaras i små alikvoter vid-20 ° C och undvika frysning-tining cykler.
    3. Mix 40 µL av CENP-F fragment (vid en koncentration på 3,3 mg/mL, eller 400 µM), 6 µL 10 x PK buffert, 3 µL ultrarent vatten, 6 µL ATP 10 x lager och 5 µL humant Cdk1/cyklin B (1 µg, 100 U) i en 0,5 mL mikrorör.
      Obs: CENP-F fragmentet har en Molmassa 8,6 kDa och fyra Cdk1-specifika fosforylering platser. För ett nytt substrat, justera kinase koncentration i analysen enligt den molära koncentrationen av protein och enligt antalet fosforylering webbplatser. Aktiviteten av humant rekombinant Cdk1/cyklin B beståndet är 20.000 U/mL, och den specifika aktiviteten är 1.000.000 U / mg. 1 U definieras som mängden Cdk1/cyklin B krävs att katalyserar överföringen av 1 pmol av fosfat till Cdk1 peptid substratet PKTPKKAKKL-NH2 (50 µM) i 1 min vid 30 ° C (se Tabell för material).
    4. Förbereda en kontroll reaktion utan Cdk1/cyklin B. Inkubera reaktionerna i ett vattenbad för 1-16 h vid 30 ° C.
  2. Analysera 2,5 µL av Kinas assay reaktionen och 2,5 µL i kontrollen av SDS-PAGE (steg 3.11), använder en gel med 16% akrylamid. För att öka upplösningen, utvidga den rinnande tiden.
  3. Tillsätt en motsvarande volym 6 M guanidin hydroklorid lösning till det återstående kinase assay reaktionen (och kontrollen). Den slutliga guanidin hydroklorid koncentrationen blir 3 M. analysera dessa prover med masspektrometri (avsnitt 6) att identifiera de phosphorylation webbplatserna eller skicka proverna till en masspektrometri anläggning för analys och sedan utföra () funktionen kontroll (Se avsnitt 7).
    Obs: För efterföljande masspektrometri analysen, det är mycket viktigt att fosforylering effektiviteten av de enskilda webbplatser är så hög som möjligt, helst 100%, som annars fosforylering webbplatser kan inte mappas. Till att kraftigt öka fosforylering effektivitetsvinster, lägga större mängder av Cdk1/cyklin B och inkubationstiden till 16 h. Koncentrationen av ATP kan också dubbleras.
  4. För felsökning, utföra en in vitro- Kinas haltbestämning av CENP-F (2,987-3 065 rester) som positiv kontroll. Använd färska partier av Cdk1/cyklin B med hög aktiviteter.

6. identifiering av Cdk1-specifika fosforylering platser av masspektrometri

  1. För att denaturera och avsalta protein proverna, utföra microbore omvänd fas vätskekromatografi med en PLRP300 kolumn.
  2. För att få antalet fosforylering platser i CENP-F fragmentet, analysera intakt i vitro fosforyleras CENP-F 84-mer genom elektrospray jonisering ion trap masspektrometri (ESI-ITMS)44,45.
  3. För att bedöma phosphoamino syra platsen för CENP-F, fosforyleras förbereda de trypsin smälter av in vitro- CENP-F protein prover. Avsalta de trypsin smälter med avsaltning Pipettera tips.
  4. Analysera de tryptic smälter CENP-f av elektrospray jonisering Fourier transform ion cyclotron resonance masspektrometri (ESI-FTICR MS). Utföra analyser på en ESI-FTICR masspektrometer med en ansamling av 169 µs.
    Obs: Noggrannheten av samlas bestäms av ESI-FTICR MS ligger inom 0,005 amu. För att kvantifiera förhållandet mellan varje respektive till beloppet som totalt protein fosforyleras art, bestämma masspektra peak höjder.

7. funktionella verifiering: Testa effekterna av Phosphomimetic mutationer på Protein-protein interaktioner genom analytiska storlek utslagning kromatografi

Obs: för funktionell kontroll av de identifiera Cdk1-specifika fosforylering webbplatser, phosphomimetic mutanter av CENP-F fragment har skapats genom att ersätta de identifiera fosforylering webbplatserna med aspartates. Negationladdningen av aspartat härmar effekterna av fosforylering. En S3048D mutant av CENP-F-fragment (rester 2,987-3 065) skapades.

  1. För funktionell kontroll, jämför bindningen av vildtyp och phosphomimetic CENP-F fragment till karyopherin α. använda en analytisk gelfiltrering som bindande analysen. För den analytiska gelfiltrering, rena CENP-F fragment av glutation affinitetskromatografi (steg 3.1-3.12), och hoppa över steget gel filtrering.
  2. Koncentrera sig proteinet till 5-6 mg/mL. Flash-frysa protein alikvoter i flytande kväve (steg 3.15-3.17).
  3. Mix av renat CENP-F fragment (0,1 mg, antingen vildtyp eller den S3048D varianten) och renat karyopherin α (0.7 mg) i förhållandet 1:1 molar. Justera provvolymen till 200 µL med gel filtrering buffert. Inkubera provet för 30 min på is, filtrera prov (0,2 µm porstorlek) och klara provet genom centrifugering (25 min, 21,700 x g, 4 ° C)
  4. Separera på prov genom storlek utslagning kromatografi (steg 3.13-3,14). Använda en buffert för filtrering av gel som består av 20 mM HEPES, pH 7.5, 150 mM NaCl, och 2 mM DTT. Utföra analytisk gel filtrering experimenten under identiska förhållanden för alla prover.
  5. Kalibrera kolumnen analytiska gel filtrering med molekylvikt standarder av kända Molmassa som beskrivs av tillverkaren.
  6. Analysera eluering fraktioner med 16% SDS-PAGE (steg 3.11).

Subscription Required. Please recommend JoVE to your librarian.

Representative Results

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Nyligen har vi använt ett test-(figur 1) in vitro- Kinas att identifiera Cdk1-specifika fosforylering platser i ett CENP-F-fragment som innehöll en cNLS10. Denna signal ger cellkärnelokalisering CENP-f under större delen av interfasen. I den G2-fasen exporteras CENP-F från kärnan till cytosolen på ett sätt som Cdk1-beroende. För att erhålla mekanistiska insikter om hur Cdk1 reglerar cellulär lokalisering av CENP-F, analyserade vi sekvens av CENP-F att förutsäga Cdk1-specifika fosforylering webbplatser, använder de iGPS server36,37. Inom cNLS CENP-f, förutspådde tre Cdk1-specifika fosforylering platser på rester 3 042, 3045, och 3 048 (tabell 1). En annan Cdk1-specifika fosforylering webbplats förutspåddes också för rester 3 007 (tabell 1)10. Därför hypotesen vi att Cdk1 reglerar CENP-F lokalisering direkt genom fosforylering av dess cNLS.

Att testa om cNLS CENP-f är ett substrat för Cdk1, utförde vi ett in vitro- Kinas test med renat mänskliga CENP-F fragmentet (rester 2,987-3 065) och mänskliga Cdk1/cyklin B. In vitro fosforyleras CENP-F analyserades på 16% SDS-PAGE, tillsammans med en negativ kontroll som saknade Kinas Cdk1 (figur 2A)10. För in vitro- fosforyleras CENP-F, observeras en klart uppåtgående SKIFT för bandet på gel jämfört med den negativa kontrollen. Detta är typiskt för fosforyleras proteiner som varje fosfatgrupp lägger två negativa laddningar och ytterligare massa. Dessa resultat tyder på att CENP-F är fosforyleras av Cdk1/cyklin B10.

Att fastställa antalet CENP-F fosforylering platser och kvantifiera fosforylering effektiviteten i dessa platser, var intakt i vitro fosforyleras CENP-F fragmentet (84-mer) analyseras av masspektrometri (ESI-ITMS)10. Den observerade ESI-ion trap masspektrum (figur 2B) antyder att det intakta CENP-F-fragmentet är fosforyleras på fyra platser (tabell 1)10.

Platsen för de fosforylerade aminosyra platserna i sekvensen av CENP-F bedömdes genom att undersöka tryptic smälter av ESI-FTICR MS. Trypsin spjälkar proteinkedjor efter lysines och arginines och ett trypsin sammandrag av CENP-F fragmentet resulterade i flera peptider, inklusive en som innehöll rester 3 031-3, 052. Masspektra av denna CENP-F-peptid överensstämde med fosforylering på rester T3042, T3045 och S3048, som är belägna inom de cNLS (tabell 1)10. Masspektra av en annan tryptic peptid (rester 2 995-3 016) överensstämde med fosforylering på S3007 (tabell 1)10. Alla fyra Cdk1-specifika fosforylering platser var också förutspådde i sekvens. Cdk1-specifika substrat innehåller ofta en proline bredvid restmängd som är fosforylerade6, som observerats för rester T3042, T3045 och S3007. Det bör noteras att S3048 är en något ovanlig Cdk1-specifika fosforylering webbplats, som en fenylalanin är beläget intill serin. Avslutningsvis, tyder resultaten på att CENP-F är specifikt fosforyleras på rester 3 007, 3 042, 3 045 och 3 048 av Kinas Cdk1. Tre av dessa rester ligger inom cNLS CENP-f (tabell 1), vilket indikerar att Cdk1 kan reglera CENP-F cellulär lokalisering genom fosforylering av cNLS i den G2-fasen, när Cdk1 blir aktiv10.

Kontrollera att dessa Cdk1-specifika fosforylering platser har en fysiologisk funktion, skapade vi den phosphomimetic varianten S3048D10. Phosphomimetic mutationer härma effekterna av fosforylering av negativt laddade rester. Nästa, vi renas den phosphomimetic versionen av CENP-F fragmentet som innehöll cNLS. CNLS CENP-f är erkänd av den nukleära transporter receptor karyopherin α, som binder med hög affinitet och krävs för nukleära import av CENP-F. För att testa om phosphomimetic mutationen försvagar samspelet mellan cNLS CENP-f med dess nukleära transporter receptor karyopherin α, utfört vi en bindande assay (figur 3)10. I dessa experiment, ett renat CENP-F-fragment (vild-typen eller den S3048D varianten) blandades med renat mänskliga karyopherin α och blandningen separerades genom analytiska storlek utslagning kromatografi. Dessutom analyseras proteinerna också individuellt. SDS-PAGE analys eluering fraktioner visade att vildtyps-CENP-F fragmentet med cNLS samverkar starkt med karyopherin α, eftersom båda proteiner Co eluera (figur 3)10. Dock endast en försumbar mängd av CENP-F S3048D-fragment binder till karyopherin α, och dessa proteiner eluera separat (figur 3)10. Dessa resultat tyder på att fosforylering av rester 3 048 av cNLS CENP-f skulle ha en stark effekt på samspelet med den nukleära transporter faktor karyopherin α. Det bör noteras att kärnkraft import priser är starkt beroende av frändskapet av en cellkärnelokalisering signal mot en nukleär transport faktor46, och därför, det förväntas att dessa mutationer sakta ner nukleära import10.

Figure 1
Figur 1: Schematisk bild av Cdk1 in vitro- Kinas analysens. Klicka här för att se en större version av denna siffra.

Figure 2
Figur 2: CENP-F är fosforyleras av Cdk1/cyklin B. (A) att identifiera Cdk1 specifika fosforylering platser, en in vitro- Kinas analys utfördes med renat CENP-F (2,987-3 065 rester). SDS-PAGE analys av en negativ kontroll utan Cdk1/cyklin B visas i vänster körfält (-Cdk1), bredvid i vitro fosforyleras CENP-F i höger körfält (+ Cdk1). Molekylär vikt anges. Observera uppåtvinkling fosforylerade CENP-f på SDS-PAGE, vilket är förenligt med framgångsrika fosforylering. Cdk1 och cyklin B visas som svag band 34 kDa och 60 kDa. (B) ESI-ion trap masspektrometri intakt fosforylerade CENP-f från (A) användes för att bestämma fosfat belastning av intakt fosforylerade CENP-F (84-mer). Den motsvarande masspektrum visas. Intensiteten är plottade kontra förhållandet massa-till-avgift (m/z). Spektrumet visar på + 10 till + 14 laddningstillstånd av intakt CENP-F-fragment efter fosforylering. De anger en arter befolkning med 0, 1, 2, 3 och 4 fosfatestrar. För att kvantifiera förhållandet mellan varje art totalprotein belopp, de toppar bestämdes och jämfört (tabell 1). Denna siffra har ändrats från10 och var Reproducerad med tillstånd av Taylor och Francis utgivare. Klicka här för att se en större version av denna siffra.

Figure 3
Figur 3: funktionella verifiering: phosphomimetic mutationer i CENP-F starkt minska interaktionen med den nukleära transporter receptor karyopherin α. (AF) Renat CENP-F fragment (rester 2,987-3 065) (0,1 mg) och renat karyopherin α (0,7 mg), och var blandade i 1:1 molar förhållandet och analyseras av storlek utslagning kromatografi. Den CENP-F fragment och karyopherin α analyserades också individuellt. SDS-PAGE analys av peak fraktioner visas. Eluering volymer indikeras längst (i 0,6 mL steg). Till vänster indikeras positioner molekylvikt markör band och deras massorna i kDa. En asterisk markerar spår av kvarvarande GST (glutation S-transferas). (A) Karyopherin α. (B) eluering profiler. Absorbansen vid 280 nm ritas versus elutionsvolymen. Eluering profilen för karyopherin α (röd) är övertäckt med eluering profiler av blandningar av karyopherin α med CENP-F fragment (vildtyp: green; phosphomimetic S3048D mutant: blå). Observera att tillägg av vild typ CENP-F fragmentet skiftar elutionsvolymen karyopherin α topp till större massa, vilket är förenligt med bindningen av CENP-F vildtyps-fragmentet. Denna förskjutning är inte iakttas när CENP-F fragmentet med phosphomimetic mutation S3048D tillsätts, vilket tyder på att phosphomimetic mutationen kraftigt minskar samspelet mellan CENP-F med karyopherin α. (C) CENP-F vildtyp fragment (wt) och karyopherin α. (D) CENP-F wt fragment. (E) CENP-F S3048D fragment och karyopherin α. (F) CENP-F S3048D fragment. Denna siffra skapades med data från10. Klicka här för att se en större version av denna siffra.

Tabell 1A. Sekvens av CENP-F-fragment (rester 2987-3065) med förutspådde Cdk1-specifika fosforylering platser markerade med större teckenstorlek. Tryptic fragment är markerade med fetstil och understruken.
GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS
GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE
Tabell 1B. Masspektrometri analys av intakt CENP-F
84 mer efter in vitro- fosforylering med Cdk1/cyklin B
# av fosforylering platser (P) upptäckts Fosfat belastningen uttryckt i % av totala protein
CENP-F 2987-3065 0P 6%
1 P 37%
2P 40%
3P 15%
4P 3%
Tabell 1C. Masspektrometri analys av tryptic peptider CENP-f efter in vitro- fosforylering med Cdk1/cyklin B
# av fosforylering platser Fosfat belastning
Tryptic phosphopeptide, 0P 57%
rester 2995-3016 1 P 43%
Tryptic phosphopeptide, 0P 7%
rester 3031-3052 1 P 64%
2P 29%
3P 1%

Tabell 1: Samlas spectrometry analys av CENP-F-fragment efter in vitro- fosforylering med Cdk1/cyklin B. Den här tabellen skapades med data från10.

Subscription Required. Please recommend JoVE to your librarian.

Discussion

or Start trial to access full content. Learn more about your institution’s access to JoVE content here

Vår i vitro kinase analysen är en mycket kraftfull metod att identifiera molekylära mål för Kinas Cdk1, som är en master controller av cellcykeln och reglerar många viktiga cellulära processer. Metoden avgör om ett renat protein är ett substrat för Cdk1 och tillåter identifiering av specifika fosforylering platser. Detta underlättar mekanistiska studier för reglering av cellulära processer genom fosforylering via Cdk1.

Den mest kritiska faktorn för framgångsrik identifiering av områdena fosforylering av masspektrometri är fosforylering effektivitet kinase analysens. Fosforylering effektiviteten i de enskilda webbplatser bör vara så högt som möjligt, helst 100%. Detta kan uppnås genom att öka mängden av Cdk1/cyklin B och öka inkubationstiden till 16 h. När beräkningen av Cdk1/cyklin B behövde, molära koncentrationen av proteinet och antalet fosforylering platser bör övervägas. Detta är särskilt viktigt om flera fosforylering platser i målproteinet. Det bör också noteras att aktiviteten av kommersiella Cdk1/cyklin B kan variera från batch till batch, och att Kinas kan förlora verksamhet snabbt. Om in vitro- fosforylering misslyckas, är det rekommenderat att testa aktiviteten av Kinas. Som positiv kontroll för felsökning, kan in vitro- fosforylering av CENP-F (2,987-3 065 rester) användas. Som en negativ kontroll, bör en reaktion utan Cdk1/cyklin B tillägg utföras och analyseras. En annan användbar negativ kontroll är användningen av en tyrosinkinashämmare-döda mutant av Cdk1, som är katalytiskt inaktiv, på grund av en enkel punktmutation (D146N)47,48,49. Dessutom kontrollera identifierade fosforylering platser, kan en phosphonegative version av målproteinet skapas, där de phosphorylation webbplatserna ersätts med alanines. Om de identifiera fosforylering webbplatserna är korrekt, inte motsvarande phosphonegative mutant fosforyleras in vitro.

Ett enkelt verktyg för att identifiera framgångsrika fosforylering av målproteinet är den enkla SDS-PAGE gel Skift-analysen som beskrivs här. Fosforyleras proteiner migrera vanligen långsammare på SDS-PAGE än sina motsvarigheter i unphosphorylated, på grund av ökad storlek och negativa laddningar. Observera att för stora proteiner, optimering av SDS-PAGE analys krävs för att öka upplösningen tillräckligt för att visualisera gel skiftet. Ett användbart verktyg för den specifika separationen av fosforyleras proteiner är fosfat-bindande tagga (Phos-tagg) SDS-PAGE. Fosforyleras proteiner i en gel som tillagas med Phos-tag akrylamid visualiseras som långsammare migrera band jämfört med motsvarande defosforyleras proteiner50,51.

För att få hög kvalitet masspektrum, är det mycket viktigt att proteinet för in vitro- Kinas analysen är ren och homogen. Vår rening protokoll uppnår detta genom att kombinera flera mycket selektiv kromatografi steg och genom att förhindra proteinnedbrytning och oxidation genom tillägg av proteashämmare och reduktionsmedel. Protokollet rening kan ändras för att eluera proteinet av glutation (dvs.med GST-etiketten intakt); Det bör dock övervägas att GST-taggen lägger en annan 25 kDa och stora proteiner är utmanande mål för masspektrometri. Alternativt våra rening protokoll för hans6-taggen fusionsproteinerna kan också användas.

Detta protokoll kan också ändras för att identifiera fosforylering platser som är specifika för andra kinaser. Det enda kravet är att den renade kreatinkinas är tillgängliga, aktiva och tillräckligt stabil. Assay villkor behöver justeras för varje kinase att uppnå maximal aktivitet. Parametrar för att optimera inräkna beloppet av kinase, reaktion buffert (pH, salt koncentration), inkubationstid, reaktion temperatur och ATP koncentrationen. In vitro kinase analyser har framgångsrikt använts för att identifiera fosforylering platser för många kinaser inklusive Plks (polo-liknande kinaser)52,53,54, och MAPK/ERK kinaser (mitogen-aktiverat protein kinaser / extracellulär signal-reglerade kinaser)55,56.

Styrkan i denna metod är att identifiera specifika fosforylering platser i ett renat protein, bör det noteras att en fosforylering webbplats som är ett mål för Cdk1 in vitro inte nödvändigtvis kan fosforyleras i vivo. I vivo, ytterligare reglerande mekanismer är i förlägga, som kunde göra en fosforylering sajt oåtkomlig för erkännande av Cdk1. Till exempel kan ytterligare interaktion partners vara närvarande i vivo, som kunde dölja en fosforylering webbplats eller göra den tillgänglig genom strukturella förändringar. Underlaget måste dessutom colocalize med Cdk1/cyklin B i kärnan i den G2-fasen för att vara fosforyleras. Dessutom, kan post-translationella modifieringar eller andra rättsliga processer påverka konformation av den mål protein i vivo, som kunde göra en fosforylering sajt oåtkomlig. Dessa begränsningar kan övervinnas genom att utforma lämpliga experiment i celler eller djurmodeller som verifierar att de identifiera fosforylering webbplatserna har en fysiologisk funktion. Här använder vi en enkel bindning analys för funktionell kontroll, eftersom fosforylering minskar samspelet mellan CENP-F med karyopherin α. funktionell kontroll även bör utföras i samband med celler eller en djurmodell. Därför har vi också transfekterade fluorescerande fusionsproteinerna CENP-F-fragment som innehöll cNLS in HeLa celler10. Phosphomimetic mutationer inom cNLS CENP-f minskade cellkärnelokalisering, som bekräftade en fysiologisk funktion av dessa fosforylering platser10.

Det finns flera verktyg för funktionell kontroll av fosforylering platser i celler eller djurmodeller. Phosphomimetic mutationer, som härmar effekterna av fosforylering av negativa laddningar, används för detta ändamål. För dessa ersätts webbplatsen fosforylering (serin eller treonin) av aspartat eller glutamat. Fördelen är att det krävs endast en punktmutation i målproteinet. Det bör noteras, att medan phosphomimetic mutationer användes framgångsrikt i många fall för funktionell kontroll, de särskilt fungerar i fall där kostnad ändringar är den dominerande bidragsgivaren för förordning i stället för en strukturell förändring. Phosphomimetic mutationer misslyckas att efterlikna effekterna av fosforylering i många andra fall (t.ex., 11). Andra metoder är dock tillgängliga för funktionell kontroll av fosforylering platser, inklusive användning av phosphonegative mutationer: dessa mutationer förhindra fosforylering genom att ersätta fosforylering platser med alanin. En annan användbar metod för funktionell kontroll i cellulära sammanhang är ett uttryck för en tyrosinkinashämmare-döda mutant av Cdk1, som inaktiveras av en lätt-till-introducera punktmutation (D146N)47,48,49. Noterbart är är flera småmolekylära Cdk1 hämmare kommersiellt tillgängliga såsom Flavopiridol och RO-3306, som kan användas för funktionella studier antingen i celler eller djurmodeller7,8,11. Dessa hämmare är välkarakteriserad, och flera är i kliniska prövningar för behandling av cancer (för en granskning se9).

Ett stort antal protein fosforylering platser har identifierats i proteomiska studier, Kinas specificiteten är i de flesta fall okänd medan Kinas in vitro- analysen är en av de få metoderna som är tillgängliga för att identifiera substrat för Cdk1. Andra metoder har också använts. Cdk1 mål identifierades med hjälp av en konstruerad Cdk1 enzym. Det har en större substrat bindande ficka och accepterar mer skrymmande versioner av ATP som ett substrat6. Detta skrymmande substrat kan inte bindas till vildtyp kinaser. Tillägg av radiomärkt skrymmande ATP till en cell extrakt som innehåller enzymet modifierade Cdk1 leder därför till särskild märkning av de direkta substratesna för Cdk1. 200 Cdk1 mål identifierades i spirande jäst med denna metod; dock tillämpas inte det på däggdjursceller, vilket är en avgörande begränsning. En annan studie identifierades Cdk1 substrat i mänsklig vävnad kultur celler genom att utföra kvantitativ phosphoproteomics analys med hjälp av två småmolekylära hämmare av Cdk1, Flavopiridol och RO-3306. 1215 phosphopeptides på 551 proteiner betydligt vid Cdk1 hämmare tillägg7. Denna metod kan skärmen en hel proteomet för potentiella Cdk1 mål, men leder mål behöver kontrolleras, t.ex., av ett in vitro- Kinas assay.

In vitro- Kinas analysen kommer i framtiden, sannolikt kombineras med hög genomströmning skärmar för Cdk1 substrat som är för närvarande under utveckling. På grund av det stora antalet Cdk1 substrat i proteomet, många mänskliga Cdk1 substrat återstår identifieras, och in vitro- Kinas analysen kommer att vara ett viktigt verktyg för att identifiera, kartlägga och kontrollera dessa platser.

In vitro- Kinas analysen är ett kraftfullt verktyg att identifiera mål för Kinas Cdk1 och identifiera specifika fosforylering platser. Identifiering av webbplatserna fosforylering aktiverar mekanistiska studier för reglering av cellulära processer av Cdk1.

Subscription Required. Please recommend JoVE to your librarian.

Disclosures

Författarna har något att avslöja.

Acknowledgments

Vi tackar Dr. David King, Howard Hughes Medical Institute, University of California i Berkeley för masspektrometri analys och hjälpsamma kommentarer. Vi tackar Dr. Xuelian Zhu, Shanghai, institut för biologiska vetenskaper, kinesiska vetenskapsakademin, Shanghai, Kina för att tillhandahålla en fullängds CENP-F-konstruktion. Slutligen, vi tackar Dr. Susan Bane, Dr Brian Callahan och Dr Christof Grewer vid Binghamton University för tillgång till utrustning. Forskningen finansierades av stiftelsen forskning för State University of New York och Institutionen för kemi, State University of New York vid Binghamton.

Materials

Name Company Catalog Number Comments
2800 mL baffled Fernbach flask Corning 44232XL
ampicillin Gold Biotechnology A-301-25
ATP Fisher Scientfiic BP413-25
benzamidine hydrochloride Millipore Sigma B6506-25
bottletop filter Corning 431161
Cdk1/cyclin B recombinant, human 20,000 U/mL New England Biolabs P6020
Cdk1/cyclin B (alternate source) EMD Millipore 14-450
Cdk1/cyclin B (alternate source) Invitrogen PV3292
Cdk1/cyclin B + 10x PK buffer New England Biolabs P6020
CENP-F (residues 2987 – 3065) pGEX6P1 plasmid Available upon request.
centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor Thermo Scientific 10033-778
centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes EMD Millipore UFC900324
chlorampenicol Gold Biotechnology C-105-100
D/L methionine Agros Organics / Fisher 125650010
desalting pipet tips: Zip tips Millipore Sigma ZTC18S008
disposable chromatography columns, Econo-Pac 1.5 x 12 cm Biorad 7321010
dithiothreitol Gold Biotechnology DTT50
E. coli Rosetta 2(DE3)pLysS strain EMD Millipore 71403
electrospray ionization Fourier transform ion Bruker Amazon Apex III
cyclotron resonance mass spectrometer
electrospray ionization ion trap mass spectrometer Bruker Amazon custom
fixed angle rotor: Fiberlite F15-8x-50cy Thermo Scientific 97040-276
FPLC system: Äkta Pure FPLC GE Healthcare 29032697
Gel filtration column: Superdex 200 Increase 10/300 GL GE Healthcare 28990944
glutathione agarose Pierce 16101
glutathione, reduced Millipore Sigma G4251-50g
incubation shaker: multitron shaker Infors I10102
isopropyl β-D-1-thiogalactopyranoside Gold Biotechnology I2481C50
kanamycin Gold Biotechnology K-120-25
karyopherin α pet-28a pres plasmid Available upon request.
Luria Bertani medium Fisher Scientfiic BP1426-2
microcentrifuge 5418R, refrigerated Eppendorf 5401000013
microtubes (0.5 mL) Eppendorf 30121023
microtubes (1.5 mL) Eppendorf 30120086
Nickel affinity gel: His-Select Nickel affinity gel Millipore Sigma P6611-100ml
pGEX-6P-1 plasmid Millipore Sigma GE28-9546-48
phenylmethylsulfonyl fluoride Gold Biotechnology P470-10
PS protease: PreScission protease GE Healthcare 27084301
Phos-tag acrylamide Wako Pure Chem. Ind. 304-93521
reduced gluthathione Millipore Sigma G4251-50g
roundbottom centrifuge tubes (Oakridge tubes) Fisher Scientfiic 055291D
site-directed mutagenesis kit: QuikChange Lightning Agilent 210518
Site-Directed Mutagenesis Kit
sonifier: Branson S-250D sonifier Branson 15 338 125
Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff) Spectrum Labs 08 670B
swing out rotor TX-1000 Thermo Scientific 10033-778

DOWNLOAD MATERIALS LIST

References

  1. Nurse, P. Cyclin dependent kinases and cell cycle control (Nobel Lecture). ChemBioChem. 3, (7), 596-603 (2002).
  2. Lee, M. G., Nurse, P. Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327, 31 (1987).
  3. Lohka, M. J., Hayes, M. K., Maller, J. L. Purification of maturation-promoting factor, an intracellular regulator of early mitotic events. Proc Natl Acad of Sci U S A. 85, (9), 3009-3013 (1988).
  4. Gautier, J., Norbury, C., Lohka, M., Nurse, P., Maller, J. Purified maturation-promoting factor contains the product of a Xenopus homolog of the fission yeast cell cycle control gene. Cell. 54, (3), 433-439 (1988).
  5. Gautier, J., Minshull, J., Lohka, M., Glotzer, M., Hunt, T., Maller, J. L. Cyclin is a component of maturation-promoting factor from Xenopus. Cell. 60, (3), 487-494 (1990).
  6. Ubersax, J. A., Woodbury, E. L., Quang, P. N., Paraz, M., Blethrow, J. D., Shah, K., Shokat, K. M., Morgan, D. O. Targets of the cyclin-dependent kinase Cdk1. Nature. 425, (6960), 859-864 (2003).
  7. Petrone, A., Adamo, M. E., Cheng, C., Kettenbach, A. N. Identification of Candidate Cyclin-dependent kinase 1 (Cdk1) Substrates in Mitosis by Quantitative Phosphoproteomics. Mol Cell Proteomics. 15, (7), 2448-2461 (2016).
  8. Vassilev, L. T., Tovar, C., Chen, S., Knezevic, D., Zhao, X., Sun, H., Heimbrook, D. C., Chen, L. Selective small-molecule inhibitor reveals critical mitotic functions of human CDK1. Proc Natl Acad of Sci U S A. 103, (28), 10660-10665 (2006).
  9. Balakrishnan, A., Vyas, A., Deshpande, K., Vyas, D. Pharmacological cyclin dependent kinase inhibitors: Implications for colorectal cancer. World J Gastroenterol. 22, (7), 2159-2164 (2016).
  10. Loftus, K. M., Coutavas, E., Cui, H., King, D., Ceravolo, A., Pereiras, D., Solmaz, S. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F. Cell Cycle. 16, (15), 1414-1429 (2017).
  11. Baffet, A. D., Hu, D. J., Vallee, R. B. Cdk1 activates pre-mitotic nuclear envelope dynein recruitment and apical nuclear migration in neural stem cells. Dev Cell. 33, (6), 703-716 (2015).
  12. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M. F., Piwnica-Worms, H., Cantley, L. C. Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol. 4, (11), 973-982 (1994).
  13. Malumbres, M. Cyclin-dependent kinases. Genome Biol. 15, (6), 122 (2014).
  14. Peeper, D. S., Parker, L. L., Ewen, M. E., Toebes, M., Hall, F. L., Xu, M., Zantema, A., van der Eb, A. J., Piwnica-Worms, H. A- and B-type cyclins differentially modulate substrate specificity of cyclin-cdk complexes. EMBO J. 12, (5), 1947-1954 (1993).
  15. Trembley, J., Ebbert, J., Kren, B., Steer, C. Differential regulation of cyclin B1 RNA and protein expression during hepatocyte growth in vivo. Cell Growth Differ. 7, (7), 903-916 (1996).
  16. Pines, J., Hunter, T. The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B. EMBO J. 13, (16), 3772-3781 (1994).
  17. Morgan, D. O. Principles of CDK regulation. Nature. 374, 131 (1995).
  18. Larochelle, S., Merrick, K. A., Terret, M. -E., Wohlbold, L., Barboza, N. M., Zhang, C., Shokat, K. M., Jallepalli, P. V., Fisher, R. P. Requirements for Cdk7 in the assembly of Cdk1/cyclin B and activation of Cdk2 revealed by chemical genetics in human cells. Mol cell. 25, (6), 839-850 (2007).
  19. Parker, L. L., Sylvestre, P. J., Byrnes, M. J., Liu, F., Piwnica-Worms, H. Identification of a 95-kDa WEE1-like tyrosine kinase in HeLa cells. Proc Natl Acad of Sci U S A. 92, (21), 9638-9642 (1995).
  20. Atherton-Fessler, S., Parker, L. L., Geahlen, R. L., Piwnica-Worms, H. Mechanisms of p34cdc2 regulation. Mol Cell Biol. 13, (3), 1675-1685 (1993).
  21. Liu, F., Stanton, J. J., Wu, Z., Piwnica-Worms, H. The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 17, (2), 571-583 (1997).
  22. McGowan, C. H., Russell, P. Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 12, (1), 75-85 (1993).
  23. Strausfeld, U., Labbé, J. C., Fesquet, D., Cavadore, J. C., Picard, A., Sadhu, K., Russell, P., Dorée, M. Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein. Nature. 351, 242 (1991).
  24. Leuken, R., Clijsters, L., Wolthuis, R. To cell cycle, swing the APC/C. Biochim Biophys Acta. 1786, (1), 49-59 (2008).
  25. Acquaviva, C., Pines, J. The anaphase-promoting complex/cyclosome: APC/C. J Cell Sci. 119, (12), 2401-2404 (2006).
  26. Zhu, X., Chang, K. -H., He, D., Mancini, M. A., Brinkley, W. R., Lee, W. -H. The C-terminus of mitosin is essential for its nuclear localization, centromere/kinetochore targeting, and dimerization. J Biol Chem. 270, (33), 19545-19550 (1995).
  27. Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B., Yen, T. J. CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J Cell Biol. 130, (3), 507-518 (1995).
  28. Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W., Yen, T. J. CENP-F is a ca 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil Cytoskeleton. 26, (3), 214-226 (1993).
  29. Christie, M., Chang, C. -W., Rona, G., Smith, K. M., Stewart, A. G., Takeda, A. A. S., Fontes, M. R. M., Stewart, M., Vertessy, B. G., Forwood, J. K., Kobe, B. Structural biology and regulation of protein import into the nucleus. J Mol Biol. 428, (10A), 2060-2090 (2016).
  30. Zuccolo, M., Alves, A., Galy, V., Bolhy, S., Formstecher, E., Racine, V., Sibarita, J. B., Fukagawa, T., Shiekhattar, R., Yen, T., Doye, V. The human Nup107/160 nuclear pore subcomplex contributes to proper kinetochore functions. EMBO J. 26, 1853-1864 (2007).
  31. Bolhy, S., Bouhlel, I., Dultz, E., Nayak, T., Zuccolo, M., Gatti, X., Vallee, R., Ellenberg, J., Doye, V. A Nup133-dependent NPC-anchored network tethers centrosomes to the nuclear envelope in prophase. J Cell Biol. 192, (5), 855-871 (2011).
  32. Hu, D. J., Baffet, A. D., Nayak, T., Akhmanova, A., Doye, V., Vallee, R. B. Dynein recruitment to nuclear pores activates apical nuclear migration and mitotic entry in brain progenitor cells. Cell. 154, (6), 1300-1313 (2013).
  33. Vergnolle, M. S., Taylor, S. S. Cenp-F links kinetochores to Ndel1/Nde1/Lis1/Dynein microtubule motor complexes. Curr Biol. 17, (13), 1173-1179 (2007).
  34. Yang, Z. Y., Guo, J., Li, N., Qian, M., Wang, S. N., Zhu, X. L. Mitosin/CENP-F is a conserved kinetochore protein subjected to cytoplasmic dynein-mediated poleward transport. Cell Res. 13, (4), 275-283 (2003).
  35. Yang, Z., Guo, J., Chen, Q., Ding, C., Du, J., Zhu, X. Silencing mitosin induces misaligned chromosomes, premature chromosome decondensation before anaphase onset, and mitotic cell death. Mol Cell Biol. 25, (10), 4062-4074 (2005).
  36. Xue, Y., Ren, J., Gao, X., Jin, C., Wen, L., Yao, X. GPS 2.0, a tool to predict kinase-specific phosphorylation sites in hierarchy. Mol Cell Proteomics. 7, (9), 1598-1608 (2008).
  37. Song, C., Ye, M., Liu, Z., Cheng, H., Jiang, X., Han, G., Songyang, Z., Tan, Y., Wang, H., Ren, J., Xue, Y., Zou, H. Systematic analysis of protein phosphorylation networks from phosphoproteomic data. Mol Cell Proteomics. 11, (10), 1070-1083 (2012).
  38. UniProt-Consortium. UniProt: the universal protein knowledgebase. Nucleic Acids Res. 45, (D1), D158-D169 (2017).
  39. Olsen, J. V., Vermeulen, M., Santamaria, A., Kumar, C., Miller, M. L., Jensen, L. J., Gnad, F., Cox, J., Jensen, T. S., Nigg, E. A., Brunak, S., Mann, M. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Science Signal. 3, (104), ra3 (2010).
  40. Dephoure, N., Zhou, C., Villén, J., Beausoleil, S. A., Bakalarski, C. E., Elledge, S. J., Gygi, S. P. A quantitative atlas of mitotic phosphorylation. Proc Natl Acad of Sci U S A. 105, (31), 10762-10767 (2008).
  41. Rona, G., Marfori, M., Borsos, M., Scheer, I., Takacs, E., Toth, J., Babos, F., Magyar, A., Erdei, A., Bozoky, Z., Buday, L., Kobe, B., Vertessy, B. G. Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights. Acta Cryst D. 69, (12), 2495-2505 (2013).
  42. Harreman, M. T., Kline, T. M., Milford, H. G., Harben, M. B., Hodel, A. E., Corbett, A. H. Regulation of nuclear import by phosphorylation adjacent to nuclear localization signals. J Biol Chem. 279, (20), 20613-20621 (2004).
  43. Kosugi, S., Hasebe, M., Tomita, M., Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc Natl Acad Sci U S A. 106, (25), 10171-10176 (2009).
  44. McLachlin, D. T., Chait, B. T. Analysis of phosphorylated proteins and peptides by mass spectrometry. Curr Opin Chem Biol. 5, (5), 591-602 (2001).
  45. Van Berkel, G. J., Glish, G. L., McLuckey, S. A. Electrospray ionization combined with ion trap mass spectrometry. Anal Chem. 62, (13), 1284-1295 (1990).
  46. Hodel, A. E., Harreman, M. T., Pulliam, K. F., Harben, M. E., Holmes, J. S., Hodel, M. R., Berland, K. M., Corbett, A. H. Nuclear localization signal receptor affinity correlates with in vivo localization in Saccharomyces cerevisiae. J Biol Chem. 281, (33), 23545-23556 (2006).
  47. Hong, K. U., Kim, H. -J., Kim, H. -S., Seong, Y. -S., Hong, K. -M., Bae, C. -D., Park, J. Cdk1-Cyclin B1-mediated Phosphorylation of Tumor-associated Microtubule-associated Protein/Cytoskeleton-associated Protein 2 in Mitosis. J Biol Chem. 284, (24), 16501-16512 (2009).
  48. Meraldi, P., Lukas, J., Fry, A. M., Bartek, J., Nigg, E. A. Centrosome duplication in mammalian somatic cells requires E2F and Cdk2–Cyclin A. Nature Cell Biol. 1, 88 (1999).
  49. Heuvel, S., Harlow, E. Distinct roles for cyclin-dependent kinases in cell cycle control. Science. 262, (5142), 2050-2054 (1993).
  50. Kinoshita, E., Kinoshita-Kikuta, E., Takiyama, K., Koike, T. Phosphate-binding Tag, a New Tool to Visualize Phosphorylated Proteins. Mol Cell Proteomics. 5, (4), 749-757 (2006).
  51. Takeda, H., Kawasaki, A., Takahashi, M., Yamada, A., Koike, T. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry of phosphorylated compounds using a novel phosphate capture molecule. Rapid Commun Mass Spectrom. 17, (18), 2075-2081 (2003).
  52. Linder, M. I., Köhler, M., Boersema, P., Weberruss, M., Wandke, C., Marino, J., Ashiono, C., Picotti, P., Antonin, W., Kutay, U. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell. 43, (2), (2017).
  53. Arai, T., Haze, K., Iimura-Morita, Y., Machida, T., Iida, M., Tanaka, K., Komatani, H. Identification of β-catenin as a novel substrate of polo-like kinase 1. Cell Cycle. 7, (22), 3556-3563 (2008).
  54. Hansen, D. V., Tung, J. J., Jackson, P. K. CaMKII and Polo-like kinase 1 sequentially phosphorylate the cytostatic factor Emi2/XErp1 to trigger its destruction and meiotic exit. Proc Natl Acad of Sci U S A. 103, (3), 608-613 (2006).
  55. Zhang, Y., Dong, Z., Nomura, M., Zhong, S., Chen, N., Bode, A. M., Dong, Z. Signal Transduction Pathways Involved in Phosphorylation and Activation of p70S6K Following Exposure to UVA Irradiation. J Biol Chem. 276, (24), 20913-20923 (2001).
  56. Richard, D. E., Berra, E., Gothié, E., Roux, D., Pouysségur, J. p42/p44 Mitogen-activated Protein Kinases Phosphorylate Hypoxia-inducible Factor 1α (HIF-1α) and Enhance the Transcriptional Activity of HIF-1. J Biol Chem. 274, (46), 32631-32637 (1999).
Identifiering av cyklin-beroende Kinase 1 särskilda fosforylering platser av ett <em>In Vitro</em> -Kinas Assay
Play Video
PDF DOI DOWNLOAD MATERIALS LIST

Cite this Article

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).More

Cui, H., Loftus, K. M., Noell, C. R., Solmaz, S. R. Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay. J. Vis. Exp. (135), e57674, doi:10.3791/57674 (2018).

Less
Copy Citation Download Citation Reprints and Permissions
View Video

Get cutting-edge science videos from JoVE sent straight to your inbox every month.

Waiting X
simple hit counter