הנדסת קרינה פלואורסצנטית 'הזהב' על-ידי הלחץ הסלקטיבי התאגדות של חומצות אמינו קאנונית, אנליזת חלבונים באמצעות ספקטרומטר מסה, קרינה פלואורסצנטית

Bioengineering
 

Summary

ביולוגיה סינתטית מאפשר ההנדסה של חלבונים עם מאפיינים חסרת תקדים באמצעות החדרת חומצות אמינו קאנונית co-translational. . הנה, הצגנו איך spectrally אדום-העביר גרסה של fluorophore GFP-סוג עם מאפייני ספקטרוסקופיות הרומן פלורסצנטיות, הנקרא חלבון פלואורסצנטי "זהב" (GdFP), מופק ב e. coli באמצעות הלחץ הסלקטיבי ההתאגדות (SPI).

Cite this Article

Copy Citation | Download Citations | Reprints and Permissions

Baumann, T., Schmitt, F. J., Pelzer, A., Spiering, V. J., Freiherr von Sass, G. J., Friedrich, T., Budisa, N. Engineering 'Golden' Fluorescence by Selective Pressure Incorporation of Non-canonical Amino Acids and Protein Analysis by Mass Spectrometry and Fluorescence. J. Vis. Exp. (134), e57017, doi:10.3791/57017 (2018).

Please note that all translations are automatically generated.

Click here for the english version. For other languages click here.

Abstract

חלבונים פלורסנט הם כלי יסוד מדעי החיים, בפרט על ידי קרינה פלואורסצנטית מיקרוסקופיה של תאים חיים. בעוד גרסאות פראי-סוג של הנדסה של חלבון פלואורסצנטי ירוק של ויקטוריה Aequorea (avGFP), כמו גם homologs של מינים אחרים כבר מכסה חלקים גדולים של הספקטרום אופטי, פער ספקטרלי נשאר באזור הקרוב אינפרא אדום, עבור איזה fluorophores מבוססי avGFP אינן זמינות. אדום-העביר חלבון פלואורסצנטי (FP) משתנים באופן משמעותי ירחיב את ערכת הכלים עבור unmixing ספקטרלי של מספר מינים מולקולרית, אך FPs אדום-העביר המתרחשים באופן טבעי המופק אלמוגים או שושנת ים יש התחתון התשואה קוונטית פלורסצנטיות, נחות צילום-יציבות יחסית על גרסאות avGFP. מניפולציה נוספת והרחבה אפשרי של מערכת מצומדת של כרומופור לכיוון האזור ספקטרלי מרחיקת אדום גם מוגבל על ידי הרפרטואר של 20 חומצות אמינו הקנוני שקבע את הקוד הגנטי. כדי להתגבר על מגבלות אלה, ביולוגיה סינתטית ניתן להשיג עוד ספקטרלי אדום-shifting באמצעות החדרת חומצות אמינו קאנונית לתוך הטראיידים כרומופור. אנו מתארים את היישום של SPI למשתנים avGFP מהנדס עם תכונות ספקטרליות הרומן. ביטוי חלבון מבוצע במסגרת טריפטופן-auxotrophic e. coli זן ועל ידי שכשהם צמיחה מדיה עם מבשרי אינדול מתאימים. בתוך התאים האלה מבשרי מומר טריפטופן אנלוגים המתאימים, שולבו חלבונים על ידי המנגנון ribosomal בתגובה UGG codons. החלפת Trp-66 "ציאן" גרסה משופרת של avGFP (ECFP) על ידי תורם אלקטרון 4-aminotryptophan גורמת GdFP שמציעות משמרת סטוקס nm 108 של פליטה בחום אדום-העביר המרבי (574 nm), בעת היותו למה יציבים יותר קודמו "ECFP". שאריות ספציפיים התאגדות של החומצה אמינית קאנונית ניתוח באמצעות ספקטרומטר מסה. המאפיינים ספקטרוסקופיות של GdFP מאופיינים על ידי קרינה פלואורסצנטית זמן לפתור ספקטרוסקופיה בתור אחד היישומים החשובים של מקודדים גנטית FPs בתחום מדעי החיים.

Introduction

מאז הגילוי של חלבון פלואורסצנטי ירוק בהמדוזה ויקטוריה Aequorea (avGFP) בשנת 19621 ואת הביטוי heterologous הראשון ב- 19942 ב שאר התאים האיקריוטים, הפכו פלורסנט חלבונים של משפחת ה-GFP מטרות בתחום מדעי החיים וכלים בעלי ערך גבוה. הנדסה גנטית ומולקולרית נרחב כללו את ההתאמה של השימוש codon תלויי מין, האצה של קיפול, התבגרות משופרת, בהירות מוגברת, מניעת oligomerization ולייעל של תכונות ספקטרליות פוטו אטמוספרי כולל היכולת הפיכה photoswitch3,4,5,6. GFP חייב שלה פלורסצנטיות שלה 4-(p- hydroxybenzylidene) כרומופור imidazolidin-5-אחת (HBDI). האחרון autocatalytically נוצר מתוך שילוש כרומופור כביכול של חומצות אמינו (Ser-65/טיר-66/Gly-67 ב- avGFP) לאחר היווצרות קשר קוולנטי נוספים בתוך עמוד השדרה פפטיד תחת ההשפעה של חמצן מולקולרי7. מערכת מצומדת מיוצב resonantly אינטראקציה דינמית עם הסביבה המולקולרי שלה, המאפשר הספיגה לטווח הגלוי, זריחה ירוק האופייני של חלבונים אלה.

בתוך השלישיה כרומופור, הנוכחות של חומצת אמינו ארומטיות היא חובה. עם זאת, הרפרטואר הסטנדרטי חומצת אמינו כוללת רק ארבע שאריות ארומטי (שלו, Phe, Trp ו- Tyr). זה מגביל גישות קונבנציונליות מוטגנזה מכוונת להשיג גרסאות avGFP אדום-העביר יותר באופן משמעותי ביחס ביותר אדום-העביר FPs טבעיים כגון DsRed8 מ מסורטטת Discosoma coralimorphs או mKate/mNeptune9 מ שושנת ים Entacmaea quadricolor. לכן, בחלק מרחיקת אדום, אינפרא אדום של הספקטרום אופטי מעל 600 nm מכוסה בדלילות על ידי גרסאות ה-GFP. זהו, כמובן, מגבלה חמורה על גישות מיקרוסקופיים פלורסצנטיות הדורשים demultiplexing ספקטרלי של מספר מינים fluorophore בו זמנית. לדוגמה, סמני זמן באורך הגל הם גם צורך לבצע שימוש של המשטר הקליטה נמוכה של רקמת העור בין 700-1000 nm הגדרות עבור רקמות עמוק הדמיה10.

פלורסנט חלבונים שמקורם avGFP מחולקים בכמה כיתות בהתבסס על מאפייני ספקטרוסקופיות כימי לאופי שלהם הן11. עם השלישיה שלו Ser-65/טיר-66/Gly-67, קיים כרומופור פראי-סוג תערובת equilibrated בין הטופס ניטרלי, בעל תאים פנוליים (λמקסימום = 395 ננומטר, חדוה = 21,000 מ-1ס מ-1) וטופס anionic phenolate (λמקסימום = 475 ננומטר, חדוה = 7,100 מטר -1ס מ-1), ומוצגים ספקטרום הפליטה לשיא יחיד-508 ננומטר. קבוצת הידרוקסיל Ser-65 יש חשיבות קריטית, כמו זה תורם של H-בונד Glu-222 בסביבה כרומופור (מרחק: 3.7 Å), אשר מקדמת את יינון של carboxylate הזה. שיעור זה מתאפיין על כרומופור anionic phenolate, כמו EGFP (Phe-64-Leu/Ser-65-חמישי; λמקסימום = 488 ננומטר, חדוה = 35,600 M-1ס מ-1, λem = 509 ננומטר). עקב ההחלפה Ser-65-Thr(Ala,Gly), הפסגה עירור nm 395 של הטופס פנול נייטרלי דיכאו והוא פסגת nm 470-475 phenolate anionic 5 - ל six פי משופרת העביר 490 nm. Class II כוללת חלבונים עם כרומופור בעל תאים פנוליים ניטרלי, כמו ספיר-GFP. כאן, ההחלפה חמישי-203-איל כמעט לחלוטין מעלימה את עירור nm 475, להשאיר רק את השיא ב 399 ננומטר. מאז כרומופור anionic לא יכול להיות כמו שצריך solvated, צורתו נייטרלי הוא המועדף. Class III כוללת על גרסאות פלורסנט "צהוב" (EYFP; Ser-65-Gly/Val-68-Leu/Ser-72-Ala/Thr-203-Tyr; חדוהמקסימום λ = 514 ננומטר, חדוה = 84, 600 מ'-1ס מ-1, λem = 527 ננומטר) עם אינטראקציה π-לערום בשרשרת בצד ארומטי, את phenolate, כפי שהביא את ההחלפות Thr-203-His(Trp,Phe,Tyr), אשר יובילו עד 20 ננומטר אדום-העביר פליטה maxima (חמישי-203-Tyr). החלפת נוספות (אך זה לא נגמר-69-ליס) תוצאות עוד 1-2 ננומטר red shift כדי 529 ננומטר, הגרסה avGFP אדום-העביר ביותר הידוע11. חילופי פנול עבור אינדול (Tyr-66-Trp) יוצר רמה ארבע, כמו ECFP ציאן-פלורסנט (Ser-65-חמישי/טיר-66-Trp; λmax1 = 434 ננומטר, חדוה = 24,800 M-1ס מ-1; λmax2 = 452 ננומטר, חדוה = 23,600 M-1ס מ-1 ; Λem1 = 477 ננומטר, λem2 = 504 ננומטר). יחידות האירוח של אינדול מגושם מופעלת כנראה על ידי אחרים, מוטציות הבולמוס. Maxima עירור, פליטה ECFP נופלים שביניהם אלה של חלבונים עם בראשון נייטרלי או anionic. Class V חלבונים הנמל של imidazole במקום פנול (Tyr-66-שלו), למשל., כחול-פלורסנט חלבונים כמו EBFP. השיעור השישי מופק על ידי החלפת פנול-אל-phenyl להעדיף את הטופס כרומופור ניטרלי באופן בלעדי, אשר כתוצאה מכך מוביל ביותר כחולים-העביר עירור, פליטה הפסגה העמדות (360 nm ו 442 nm, בהתאמה).

קלאסית מוטגנזה מתאימה במיוחד לייצור של גרסאות כרומופור avGFP רומן, על ידי התמורה של tripeptide 65-67, שאריות שמעצבת במסגרת 20 חומצות אמינו הקנוני. האפשרויות הללו ניתן להרחיב עוד יותר כאשר קאנונית וריאציות של חומצות אמינו ארומטיות הציג במהלך סינתזת חלבון ribosomal12. בעיקרון, קיימות שתי דרכים כדי להשיג את זה. האסטרטגיה הראשונה מסתמך על הסובלנות המצע של מכונות תרגום החלבון, במיוחד של aminoacyl-tRNA synthetases (aaRSs) לכיוון חומצת אמינו הקשורות תחליפי. כדי להשיג זאת עם יעילות גבוהה, auxotrophic e. coli ביטוי זנים המועסקים כי הם מסוגלים לסנתז חומצת אמינו טבעית המתאימה ביותר. דבר זה מאפשר ההחלפה של האחרון על-ידי הוספת סימנים מקדימים או מתאימים חומצות אמינו קאנונית (ncAAs) הימנו המדיום תרבות. אסטרטגיה זו, המכונה גם התאגדות לחץ סלקטיבי (SPI)13,14, מאפשר שאריות ספציפיים תחליפים, אשר לגרום ההתאגדות הגלובלית של ncAA. האסטרטגיה השנייה משתמשת stop codon tRNAs משתיק קול אשר מואשם ncAA מאת מהונדסים אנזימים aaRS. זה התוצאה readthrough של codons עצירה במסגרת ומאפשרת התאגדות המכללות הספציפיות-לאתר. כתוצאה מכך, שיטה זו של stop codon דיכוי (SCS) מוביל ההרחבה של הקוד הגנטי15. ויה מוטגנזה מכוונת, ימוקם על stop codon הגן היעד באתר הרצוי. בעקרון, SPI יכול לשמש גם כדי ליצור רקומביננטי פפטידים וחלבונים הנושאת התקנה ncAA ייחודי, בהתחשב בכך חומצות אמינו הקנוני נדירים כגון Met או Trp נבחרו עבור החלפת. עם Trp, הוכחו SPI גישות לעבודה עם מגוון גדול של תחליפי כולל - F - 4, 5 - נ - ו 6-F-Trp, 7-עזה-Trp, 4-OH - ו 5-OH-Trp, כמו גם 4 - 5-NH2- Trp או אפילו β (thienopyrrolyl) אלנין נגזרים16 ,17,18,19,20. לפיכך, SPI יכול להיות מאוד מועיל החלפת חומצות אמינו ארומטיות של GFP הן לפי משתנים קאנונית לבדוק אפשרות נוספת להתאים ספקטרה ו- shift לחוצים סטוקס של אלה FPs. לגבי כל חלבון רצף השינויים, התאימות עם ההבשלה קיפול, כרומופור FP חייב להיבדק השפעול.

בעבודה זו, אנו מנצלים class IV ECFP21, אשר נושאת במקום avGFP פראי-סוג Tyr, משקע Trp בתוך השלישיה כרומופור שלה. באמצעות SPI, זו Trp-66 (ו- Trp-57, רק אחרים Trp השאריות ב ECFP) הוא מוחלף על ידי 4-אמינו-Trp. הנוכחות של קבוצת אמינו תורם אלקטרון 4-אמינו-Trp בתוך כרומופור מיטיבה ייצוב תהודה של העברה פרוטון רחוק אדום-העביר עירור (ESPT) ניחן משמרת סטוקס 108 ננומטר. זה חלבון פלואורסצנטי "זהב" (GdFP) מהווה variant עם ההעברה האדום הגדול של המרבי ידי קרינה פלואורסצנטית (574 ננומטר) בין כל החלבונים נגזר avGFP. מאמר זה מתאר השיטה לייצור חלבון GdFP על ידי SPI ואנו מספקים את הפרוטוקולים לניתוח חובה של החלבונים ששונה הנוצרת על-ידי לספקטרומטרית מסות. יתרה מזאת, אנו מראים איך GdFP יכול להיות מנוצל וניתח בגישות ספקטרוסקופיה זריחה זמן לפתור.

Protocol

1. שינוי של Trp-auxotrophic e. coli

  1. המרה כימית או electrocompetent תאים (50 µL) של זן Trp-auxotrophic e. coli , למשל. ATTC 49980 (WP2, מוטציה נגזר מהמאמץ e. coli B/R22), עם µL 1 1 ng/µL מימית לפתרון של פלסמיד His6-ECFP pQE - 80 L באמצעות הלם חום או אלקטרופורציה, בהתאמה. נא עיין23,יופיטר מדעי החינוך מסד24 לפרטים.
    הערה: הביטוי וקטור pQE - 80L His6-ECFP מקודד של N-סופני 6 x ECFP שלו מתויג21 מונחה על ידי יזם T5 חיידקי עם אופרטור lac. הוא נושא נוסף סמן הבחירה המגברR ולמקור colE1 של שכפול (הרצף עמוד השדרה pQE - 80 L וקטור ניתן למצוא באתר: https://www.qiagen.com/mx/resources/resourcedetail?id=c3b71572-4d82-4671-a79b-96357fe926d1&lang=en & autoSuggest = true). משקל מולקולרי תיאורטי של החלבון פראי-סוג His6-ECFG (לאחר ההבשלה כרומופור25) הוא 28303.92 Da. הרצף חלבון היעד מתורגמת הוא כדלקמן (שלו-תג תחתון, וקטור הנגזרות רצפים באותיות מודגשות): MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMK
    QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGS
    VQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK.
  2. צלחת טרנספורמציה תאים על צלחות LB-אגר (טבלה 1) בתוספת 10 גרם/ליטר גלוקוז, אמפיצילין µg/mL 100, דגירה הלוחות ב 37 מעלות צלזיוס למשך הלילה.

2. ביטוי חלבון רקומביננטי

  1. תרבות לילה של e. coli בקרת האוויר 49980 pQE - 80 L His6-ECFP...
    1. להכין 5 מיליליטר בינוני ליברות (טבלה 1; בתוספת 10 גרם/ליטר גלוקוז, אמפיצילין µg/mL 100) ב- mL 14 סטרילי תרבות פוליסטירן צינור לצמיחה אירובי, לחסן עם ביחידים המושבה של צלחת אגר באמצעות לולאה עצה או חיסון פיפטה סטרילי.
      הערה: באמצעות מושבות מתאי טרי טרנספורמציה מומלץ. ניתן לאחסן הצלחות עם מושבות חיידקים (מתוך שלב 1.2.) ב 4 מעלות צלזיוס למשך מספר ימים.
    2. דגירה התאים ב 37 מעלות צלזיוס ב שייקר מסלולית-200-250 סל"ד למשך הלילה.
  2. ביטוי פראי-סוג ECFP
    1. לחסן בינוני LB טריים 10 מ"ל (טבלה 1; בתוספת 10 גרם/ליטר גלוקוז, אמפיצילין µg/mL 100) עם 100 µL של התרבות לילה ב- 100 מ ל Erlenmeyer את הבקבוק. דגירה. הבקבוק ב 37 מעלות צלזיוס ב שייקר מסלולית-200 סל ד.
      הערה: לחלופין, שלב זה ניתן לבצע 10 מ"ל NMM19 בינוני (טבלה 1) בתוספת 100 אמפיצילין µg/L ו 0.5 מ מ L-טריפטופן (לחלופין, אינדול יכול לשמש).
    2. מודדים את צפיפות אופטית על 600 nm (OD600) כל 20 דקות מעדיפים למדוד תא צפיפות על-ידי קביעת הכחדה על 600 nm (OD600) בספקטרופוטומטר באמצעות cuvette עם אורך הנתיב של 1 ס מ. תמיד לבצע הפניה מדידה באמצעות המדיום המתאים תרבות. לדלל את הדגימות ואת לערבב הדוגמאות כדי לקבל ערך מדידה של 0.1-0.8 אז חישוב OD600 באמצעות הגורם דילול. לפרטים, נא לפנות הפרסום הקודם 26.
    3. כשמגיעים ערך600 OD של 0.5-0.8 (כ 2-3 שעות לאחר חיסון), לקחת מדגם "לקראת הגיוס" עבור מרחביות-דף (סודיום dodecyl סולפט לזיהוי בג'ל, שלב 4).
    4. זירוז ביטוי חלבון היעד על-ידי התאמת התרבות נוזלית עד 0.5 מ מ IPTG (איזופרופיל β-D-1-thiogalactopyranoside, מהפתרון מניות 1 מ'), דגירה זה ב 30 מעלות צלזיוס שייקר מסלולית-סל ד 200 עבור 4-8 שעות.
      הערה: ציאן חלבונים פלורסנט מתבטאים בדרך כלל בטמפרטורות מתחת 37 ° C27.
    5. לקחת מדגם "אחרי הביטוי" עבור מרחביות-דף (שלב 4.).
    6. לקצור תאי חיידקים על ידי צנטריפוגה 10 דקות ב- 5,000 x g ו- 4 מעלות צלזיוס.
    7. למחוק את תגובת שיקוע על ידי decanting ומקפיאים את כדורי תא ב-20 ° C או -80 ° C עד טיהור חלבון המטרה.
  3. SPI להפקת GdFP
    1. לחסן 10 מ"ל NMM19 בינוני (טבלה 1) בתוספת 100 אמפיצילין µg/mL, 15 מיקרומטר טריפטופן, 10 µL של תרבות לילה ב- 100 מ ל Erlenmeyer את הבקבוק, דגירה את הבקבוקון תרבות בין לילה ב 30 מעלות צלזיוס ב שייקר מסלולית-200 סל ד.
      הערה: מגוון מדיה מוגדרים כימי לטיפוח של e. coli ו- SPI זמין. בנוסף NMM המשמשות בתקנון, המגבים בינונית28, גלוקוז-מינרליים מלחי בינוני29, דיוויס בינונית מזערי30, M9 בינונית מזערי31, או GMML32 יכול לשמש.
    2. למחרת, למדוד OD600 כל 30 דקות עד הערך משתנה רק על ידי פחות מ- 0.05 מעל 30 דקות. הערך הרמה צריכה להיות כ 1.
      הערה: סטיות ± 0.3 יחידות מקובלים. בהתאם זן חיידקי בינוני בשימוש, הריכוז ההתחלתי טריפטופן (שלב. 2.3.1) עשוי להזדקק ההתאמה.
    3. לקחת מדגם "לקראת הגיוס" עבור מרחביות-דף (שלב 4.).
    4. לקצור תאי חיידקים על ידי צנטריפוגה 10 דקות ב- 5,000 x g ו- 4 מעלות צלזיוס. למחוק את תגובת שיקוע על ידי decanting.
    5. Resuspend התאים 10 מ"ל NMM19 בינוני עם אמפיצילין µg/mL 100 לתוך 100 מ ל Erlenmeyer הבקבוק ולהוסיף 4-אמינו-אינדול ריכוז סופי של 1 מ מ באמצעות פתרון מניות 50 מ מ. המשך הדגירה למשך 30 דקות ב 30 מעלות צלזיוס ב שייקר מסלולית-200 סל ד.
      הערה: שלב זה מומלץ בגלל היציבות הכימית נמוך של אמפיצילין ומבטיחה ספיגת הסלולר של 4-אמינו-אינדול.
    6. זירוז ביטוי חלבון היעד על-ידי הוספת IPTG ריכוז סופי של 0.5 מ מ באמצעות 1 מ' מניות, דגירה המדגם בן לילה ב 30 מעלות צלזיוס ב שייקר מסלולית-200 סל ד.
      הערה: ציאן חלבונים פלורסנט מתבטאים בדרך כלל בטמפרטורות מתחת 37 ° C27.
    7. למחרת, למדוד OD600.
    8. לקחת מדגם "אחרי הביטוי" עבור מרחביות-דף (שלב 4.).
    9. לקצור תאי חיידקים על ידי צנטריפוגה 10 דקות ב- 5,000 x g ו- 4 ° C ולמחוק את תגובת שיקוע על ידי decanting.
    10. במקרה כזה כלי לא שימשו צנטריפוגה, העברה בגדר תא לתוך 50 מ ל חרוט פוליסטירן צינור בעזרת מרית. להקפיא בגדר תא ב-20 ° C או -80 ° C עד טיהור חלבון המטרה.

3. היעד טיהור חלבון באמצעות כרומטוגרפיית זיקה קיבוע יון מתכת (IMAC)

  1. פירוק תא החיידק
    1. הפשרת בגדר תא בקירור למשך 10-20 דקות.
    2. Resuspend בגדר תא 50 מ ל חרוט פוליסטירן צינור באמצעות 5 מ של איגוד כקרח מאגר (טבלה 1) על קרח.
    3. הוספת µL 20 של 50 מ"ג/מ"ל ליזוזים, µL 20 של 1 מ"ג/מ"ל DNase ואני µL 20 של 1 מ"ג/מ"ל RNase א לסגור את הצינור, לערבב בעדינות על ידי היפוך 5 פעמים ולשמור אותו על קרח למשך 30 דקות.
      הערה: לשבירת תאים חלקי מתרחש כפי על ידי ליזוזים.
    4. Lyse בתאים על-ידי sonification באמצעות tip מהמגן אולטרסאונד באמצעות שלושה מחזורים של 3 דקות 15 מ"ל צינור פוליסטירן מקורר על ידי הרפש קרח עם 2 s של הדופק, 4 s של משרעת pause ו- 45%.
      הערה: לחלופין, המגון בלחץ גבוה יכול לשמש, למשל., 20 מחזורים בבית 14,000 psi. במידת הצורך, לדלל באמצעות מאגר מחייב להגיע האחסון כלי מינימלי. יתר על כן, ניתן להשתמש חלבון החילוץ ריאגנטים עבור לשבירת תאים. ראו טבלה חומרים לדוגמאות.
    5. צנטריפוגה המדגם למשך 30 דקות ב 15,000-18,000 x g, 4 מעלות צלזיוס.
    6. להעביר את תגובת שיקוע לתוך צינור טריים הערה למטה נפח נוזל.
    7. לסנן את הפתרון דרך מסנן מזרק מיקרומטר 0.45 באמצעות מזרק נעל מ ל זכוכית פלסטיק ומסנן מזרק polyvinylidene פלואוריד (PVDF).
    8. לקחת מדגם "lysate" עבור מרחביות-דף (שלב 4.).
    9. Resuspend תא פסולת צניפה ddH2O (שווה נפח כמו לשעבר lysate).
    10. לקחת מדגם "גלולה" עבור מרחביות-דף (שלב 4.).
  2. IMAC טיהור
    1. השתמש של 1 מ"ל prepacked או עצמית ארוז IMAC FPLC (חלבון מהיר כרומטוגרפיה נוזלית) העמודה לפי הנחיות היצרן. השתמש איגוד מאגר (טבלה 1) עבור עמודה equilibration כמו גם לגבי השלב שטיפת העוקב אחרי התא lysate הוחל על העמודה.
    2. שברים eluate לאסוף ובריכה עם GdFP אשר יכול להיות מזוהה על ידי גלוי בצבע זהוב בהיר.
      הערה: לחלופין, החלבון היעד יכול להיות eluted באמצעות הדרגתי imidazole ליניארית (0-250 מ מ) באמצעות מערכת אוטומטית FPLC.
    3. לקבוע ריכוז חלבון באמצעות הערך ספרות של המקדם הכחדה-466 nm (ɛ466 nm = 23,700 מ-1 ס מ-1)33 עם מאגר • תנאי כהפניה. לפרטים על ההליך, נא עיין הפרסום הקודם26.
    4. לקחת מדגם "eluate" עבור מרחביות-דף ולהשתמש µg 1-10 של חלבון ליום ליין במקרה של Coomassie מכתים.
      הערה: כמויות לדוגמה מרחביות יכול להשתנות בהתאם שיטת ההגדלה ורגישות צבע.
    5. Dialyze של aliquot של שברים eluate נגד המאגר דיאליזה או MS המאגר באמצעות קרום עם מולקולרית משקל סף (MWCO) של 5000-10, 000. להכין את קרום דיאליזה לפי הנחיות היצרן. Dialyze מדגם 1 מ ל שלוש פעמים נגד 100 מ ל מאגר כבר לפחות שעתיים. לפרטים על הליך זה, נא עיין הפרסום הקודם34.
    6. לאחסון, להקפיא חלבון לדוגמה במאגר דיאליזה ב-80 מעלות צלזיוס.
      הערה: Aliquots צריך להיות יציב במשך לפחות 6 חודשים.

4. מרחביות-דף הכנת הדוגמא של e. coli התא כולו תמצית

  1. העברה השעיה תא שווה ערך ל 1 מ"ל של יתר600 = 1 ההשעיה (למשל-500 µL של יתר600= 2) לתוך צינור microcentrifuge 1.5 mL.
  2. לקצור את התאים על ידי צנטריפוגה 10 דקות ב 5000 x g, בטמפרטורת החדר. למחוק את תגובת שיקוע על-ידי pipetting.
  3. להוסיף µL 80 של ddH2O ו- 20 µL למען חברה דמוקרטית 5 x טעינת מאגר צבען (טבלה 1) תא צניפה, מיקס על ידי pipetting.
  4. Denature התאים על ידי חימום עד 95 מעלות צלזיוס למשך 5 דקות בתוך גוש טורקי או חום המים. לאחר מכן, מגניב הדגימות לטמפרטורת החדר.
  5. השתמש 10 µL עמודים מרחביות שהוכתמו Coomassie על פי הפרסום הקודם35.
    הערה: כמויות לדוגמה מרחביות יכול להשתנות בהתאם שיטת ההגדלה ורגישות צבע.

5. שלם המוני אנליזת חלבונים באמצעות כרומטוגרפיה נוזלית ביצועים גבוהים (HPLC) מצמידים ספקטרומטריית Electrospray יינון זמן-של-טיסה ספקטרומטר מסה (LC-ESI-תוף-MS)

הערה: HPLC מעבר צבע, הגדרות, מאגרי עשוי להשתנות בהתאם ההפרדה העמודה ואת מכשיר. ראו טבלה חומרים עבור ציוד למופת.

  1. לקבוע ריכוז חלבון מתוך מדגם דיאליזה נגד המאגר MS כמתואר לעיל (שלב 3.2.3.) באמצעות MS מאגר (ראה טבלת חומרים) כהפניה.
  2. לדלל את הדגימה חלבון כדי 0.1 מ"ג/מ"ל באמצעות MS מאגר עבור נפח סופי של 80 µL, לערבב על-ידי pipetting זהירה, להעביר את הפתרון לתוך בקבוקון תעשיה MS עם הוספת זכוכית, סגור אותו עם כובע. להסיר בועות אוויר על ידי מצליף את המבחנה.
  3. למלא בקבוקון תעשיה השני ללא זכוכית הוספה (מאגר ריק) 1 מ"ל MS המאגר.
  4. לאפשר את המכשיר להתחמם. לבצע כיול המכשיר. ודא כי כמויות מספיקות של כרומטוגרפיה נוזלית-כיתה ממיסים זמינים (> 100 מ ל).
  5. תוכנית הדרגתי HPLC ליניארי 20 דקות מ- 5% למאגר 80% (0.1% חומצה פורמית ddH2O), בשילוב עם מאגר B (0.1% חומצה פורמית ב- acetonitrile).
  6. מתחילים HPLC זרם של 0.3 mL/min והמתן עד הלחץ עמודה יציב.
  7. להגדיר אמצעי הזרקה תעשיה של µL 5 עבור שיטת LC-ESI-תוף-MS, ליצור worklist של ריק לרוץ ואחריו ריצה מדגם והקצה תעשיה התואם המבחנה עמדות. הפעל את worklist.
  8. לאחר השלמת worklist, פתח את קובץ הנתונים לדוגמה שנוצר. בחר טווח בעלילה יון סה כ הנוכחי (טיק) עבור deconvolution, deconvolute הספקטרום MS באמצעות האלגוריתם deconvolution מקסימום אנטרופיה.
    הערה: בהתאם לתנאי הניסוי, מינים נוספים יכול להתרחש מ FP שאינם התבגר או מאגר יון adducts.

6. זריחה שלמים ומדידות, ריקבון-הקשורים ספקטרום (DAS) של GdFP

הערה: עבור המכשור בספקטרוסקופית זמן לפתור, עיין בטבלה של חומרים עבור ציוד למופת. ספיגת וכן עירור קרינה פלואורסצנטית של ספקטרום הפליטה של חלבונים פלורסנט נרשמים באמצעות מכשירים UV/וויס, קרינה פלואורסצנטית מעבדה.

  1. נפתרה-גל פלורסצנטיות מדידה שלמים של GdFP
    1. להכין 2 מ של פתרון 1 מיקרומטר של GdFP על ידי דילול לתוך מאגר PBS (טבלה 1) ב- pH 7. למלא את הפתרון לתוך cuvette קוורץ 1 ס מ.
    2. התקנת פעמו ps 470 ננומטר לייזר עבור עירור מדגם של המסנן לונג-מעבר פליטה 488 ננומטר, והתאימו מ"מ/600 L grating לפוטון בקורלציה זמן אורך גל יחיד סופר36 (TWCSPC) גלאי עבור רכישת של המשטר אורך גל 500-700 nm.
    3. רוכשים פליטת קרינה פלואורסצנטית בקצב ספירה של בערך 200 x 103 פוטונים/s עד כ-10 סעיפים3 צבר ב המרבי רכישה של עקומות דעיכה זריחה עם פוטון יחיד סופר תוכנה.
  2. מדידה של פונקציית התגובה פלייבק37 (IRF)
    1. החלף את מדגם cuvette עם cuvette קוורץ 1 ס מ מלא 1 g/L colloidal סיליקה (~ 220 מ'2/g) במאגר PBS ב- pH 7.
      הערה: המתלים סיליקה מוכנה תוך שימוש השעיה מימית 400 גרם/ליטר.
    2. הסר 488 ננומטר מסנן פליטה ארוך מעברים ומסננים הוספה אפור כדי להתאים את הקצב לספור גלאי TWCSPC אל מתחת 100 x 103 ספירות/s....
    3. להתאים את הסורג לצורך רכישת 470 פוטונים nm בערוץ 8 של הגלאי TWCSPC 16 ערוצים.
    4. רוכשים את IRF עד כ 10 x 103 סעיפים שנצברו בהפליטה המרבי.
    5. המר דעיכה ופיתולים פלורסצנטיות IRF לקבצי נתוני ASCII עם הכללית התאמת תוכנית38 .
    6. מידע כללי התנהגות מתאימים על פי דגם של סכום של שלושה מרכיבים מעריכית עם משך חיים כפרמטרים מקושרים.
    7. מגרש דעיכה קשור ספקטרה (DAS) כאל משרעת הפצות של רכיבים בודדים דעיכה תלות של הגל עם תוכנת ניתוח נתונים.

Representative Results

בעזרת הטכניקה של הלחץ הסלקטיבי התאגדות, Trp-66 בשילוש כרומופור של ECFP (וגם Trp-57, רק אחרים Trp השאריות ב- ECFP) ניתן להחליף 4-אמינו-Trp, ובכך יוצר את GdFP אדום-העביר עם תכונות ספקטרליות ברורים. ספקטרומטר מסה יש להשתמש כדי להדגים stoichiometric השילוב הרצוי של החומצה אמינית קאנונית לתוך החלבון, עם תוצאות המוצג באיור1. לאחר מכן, אנו מספקים נתונים מיקרוסקופ, UV-Vis ספקטרום בליעה, כמו גם מצב יציב, זמן, אורך גל-לפתור פלורסצנטיות ספקטרוסקופיה לאפיין את המאפיינים של fluorophore GdFP עם דגש על התלות ה-pH של ספקטרה.

כדי לאשר את ההחלפה של משקעי Trp שני ב ECFP על ידי 4-אמינו-Trp, מבוצע ניתוח המוני spectrometric. איור 1 מציג קשת ESI-MS deconvoluted נציג של GdFP. בעוד ECFP פראי-סוג יש מסה חלבון מחושב של 28,283.9 Da לאחר ההבשלה כרומופור, המסה המתאים של GdFP הוא 28,313.9 Da. הספקטרום ESI-MS deconvoluted של GdFP המוצגים העיקריים לשיא מסת ב 28,314.1 ± 0.1 דא, אשר בכשליש מהערך תיאורטית פחות מ 10 עמודים לדקה. זה להיות בתוך הטווח דיוק טיפוסיים לסוג כזה של ניתוח25, מאשר שילוב של ncAA ויה SPI (ערך ניסיוני עבור ECFP פראי-סוג: 28,283.7 Da).

איור 2 מציג פלורסצנטיות קונאפוקלית הדמיה במיקרוסקופ (CFIM) תמונות של תאים חיידקיים לבטא ECFP, EGFP, EYFP, GdFP על resuspension של חיידקים במאגר PBS. כל התמונות נרכשו במיקרוסקופ מצויד עם UV אובייקטיבית, לייזר עירור-על האנרגיה עבור כל דגימה.

איור 3A מציג כיסוי של CFIM תמונות של חיידקים e. coli לבטא FPs שונים כולל GdFP, תמיד במעקב עם אנרגיה עירור דומה מאוד (אורכי גל כמו איור 2). איור 3B מראה המבנים כרומופור וריאנטים FP המוצג. לגבי הבהירות של GdFP בהשוואה ECFP (קרינה פלואורסצנטית קוונטית התשואה φ = 0.4), EGFP (φ = 0.6) ו EYFP (φ = 0.6) זה חשוב לציין כי עבור GdFP, ובמהלך רכישה של האור קרינה פלואורסצנטית (30 ננומטר) שימש לעומת 20 ננומטר המשמש עבור כל spe אחרים cies, כדי לכוונן את העוצמה של התמונות לערכים דומים. עם מקדם הכחדה נמוך במקצת, תשואה קוונטית מופחתת בשל המאפיינים הייחודיים photophysical, הבהירות של GdFP נמוכה לעומת FPs אחרים המוצגים.

ספקטרום הבליעה של ECFP (איור 3C) יש שני maxima האופיינית 434 nm ו 452 ננומטר. לעומת זאת, GdFP מאופיין על-ידי אחד הלהקה הקליטה אדום-העביר רחבה עם המרבי-466 ננומטר. קליטתם של EGFP הוא עוד יותר אדום-העביר את 488 ננומטר. עם זאת, בשל השינוי סטוקס הרבה יותר גדול של GdFP (108 ננומטר) בהשוואה ECFP (41 nm), EGFP (20 ננומטר), ספקטרום הפליטה של GdFP הוא הכי אדום-העביר של כל שלושת GFP נגזרות נחקר כאן (דמות תלת-ממד). בעוד פליטת קרינה פלואורסצנטית ECFP מראה שני maxima האופיינית 475 nm ו 505 nm, EGFP יש אחת רחבה פליטה הראשי הלהקה שדורג 508 nm (λמקסימום) עם כתף קלה-540 nm. ידי קרינה פלואורסצנטית של GdFP מופיע על 565 nm (λמקסימום) (איור תלת ממדי). ספקטרום הפליטה שלו מכיל תרומה קטנה של פראי-סוג ECFP אשר גם הוא כמו כתף קטן-475 ננומטר. זה חלק ECFP קטן הוא מסונתז לקראת הגיוס במהלך ההליך SPI, כפי שמתואר33.

איור 3E מציג את השינויים תלויי-pH ספקטרום הבליעה של GdFP. שינוי ה-pH מ- 8 ל 5, הפליטה המרבי משתנה מעט לאדום, התרחבות קלה של הלהקה הקליטה נצפית. ההפחתה של משרעת הקליטה זאת, רק כ- 10% בין pH 8 ו- pH 5, המציין כי מאפייני בקרקע כרומופור GdFP הם מאד חלש שונה על-ידי ה-pH.

הפעם החליט פליטת קרינה פלואורסצנטית בפיקוח פוטון יחיד סופר מוצג באיור4. עקומות דעיכה בפיקוח הערוצים ספקטרלי ממורכז ב 550 ננומטר ותערוכה 600 nm (איור 4A) דעיכה פלורסצנטיות מעט יותר מהר על 600 nm בהשוואה הריקבון ב 550 ננומטר. התוצאות של התפרצות גלובלית של זריחה ריקבון עקומות עם שתי תוצאות רכיבים מעריכי ברכיבי דעיכה זריחה spectrally להבדיל שני עם זמן קבועים של 1.0 ns ו 3.3 ns (איור 4C ו- D).

פליטת קרינה פלואורסצנטית GdFP תלויה בחריפות pH, כפי שהוא אופייני חלבון פלואורסצנטי וריאציות רבות של משפחת ה-GFP. איור 4B משווה את פליטת קרינה פלואורסצנטית של GdFP בין pH 5 ו- pH 8, אשר מראה בבירור ירידה בעוצמת זריחה ב- pH נמוך יותר, בעוד המאפיינים ספקטרלי נשאר קבוע.

ספקטרום קרינת-הקשורים (DAS)39 של GdFP (איור 4C ו- D) מאופיינים על ידי שתי להקות פליטה ברורים. התרומה של 3.3 איטי רכיב ns מודגש יותר בטווח אורך גל קצר בסביבות 550 ננומטר (60%) עם תרומה משנית של הרכיב מהר יותר (40%). ב 600 nm, שני הרכיבים יש בערך משרעת זהה. בעת שינוי מ- pH 7 (איור 4C) ה-pH 6 (איור 4D), המאפיינים ספקטרלי של סי בקושי לשנות, קבועי זמן מהשיגרה התאמה הכללית הם גם אותו (דיוק קבועי זמן DAS הוא על ± 0.15 ns). עם זאת, ההבדל ב- amplitudes מוחלטת של שני הרכיבים DAS הוא ברור לעין, אשר מלא חשבונות עבור משרעת פליטת קרינה פלואורסצנטית מופחת על pH בשינוי ב- 4B איור.

Figure 1
איור 1: נציג קשת ESI-MS deconvoluted GdFP. הספקטרום ESI-MS של GdFP (צבע זהב, מגרש המוגדל כמוצג שיבוץ) מראה לשיא הראשי דה 28314.1 (מחושב ערך 28313.9 Da). הספקטרום עבור פראי-סוג ECFP מוצג בשחור. אנא לחץ כאן כדי להציג גירסה גדולה יותר של הדמות הזאת.

Figure 2
איור 2: תמונות מיקרוסקופ פלורסצנטיות קונאפוקלית אוכלוסיות חיידקים לבטא FPs שונים. ההגדרות הבאות גל שימשו ייבוא תמונות: ECFP (λex = 457 ננומטר, זיהוי: 461-480 ננומטר), EGFP (λex = 488 ננומטר, זיהוי: 495-515 ננומטר), GDFP (λex = 476 ננומטר, זיהוי: 560-590 nm), EYFP (λex = 514 nm, זיהוי: 520-530 ננומטר). אנא לחץ כאן כדי להציג גירסה גדולה יותר של הדמות הזאת.

Figure 3
איור 3: ספקטראליות של GdFP. (א) CFIM תמונה של תערובת של תאים חיידקיים לבטא ECFP, EGFP, GdFP לאחר resuspension של חיידקים במאגר PBS. (B) כרומופור מבנים של GdFP (עם 4-אמינו-Trp במקום שאריות 66), ECFP הורים (עם Trp במיקום 66), EFGP (עם-טיר במיקום 66). (ג) השוואה של ספקטרום בליעה המנורמל של GdFP, ECFP, EGFP, ואילו (D), ספקטרום הפליטה פלורסצנטיות המנורמל של ECFP (עירור-430 ננומטר) לעומת ספקטרום הפליטה זריחה של EGFP ו- GdFP (שניהם מתרגשת-450 ננומטר). (E) pH-התלות של ספקטרום בליעה (מנורמל הקליטה ב- 280 ננומטר). אנא לחץ כאן כדי להציג גירסה גדולה יותר של הדמות הזאת.

Figure 4
איור 4: זמן לפתור זריחה של GdFP. קרינה פלואורסצנטית (A) דעיכה של GdFP פיקוח על-ידי זמן, אורך גל-לפתור פוטון יחיד סופר בערוצים ספקטרלי ממורכז ב 550 ננומטר ו- 600 nm (± 12.5 ננומטר) לאחר עירור עם פעימות לייזר nm 470. הפונקציה התגובה פלייבק (IRF) מספק מידע אודות הפתרון זמן של ההתקנה בשימוש. (B) וריאציה של ספקטרום הפליטה של GdFP תלויה pH (עירור-460 ננומטר). (C, D) עששת-הקשורים ספקטרום (DAS) של GdFP pH 7 (ג) ו- pH 6 (ד) נקבע לאחר deconvolution של זריחה זמן, אורך גל-לפתור נרקב, ההתאמה הכללית של נרקב בתוך כל הערוצים על ידי מערכת גלובלית של שתי פונקציות מעריכית עם מקושרים זמן קבועים. אנא לחץ כאן כדי להציג גירסה גדולה יותר של הדמות הזאת.

Figure 5
איור 5: מבנים של העברת תשלום התפלגות ECFP (שחור), הן GdFP (זהב)- הגדלת גודל המערכת כרומופור על ידי התורם אלקטרון טוב של קבוצת אמינו כחלק ncAA מאפשר היווצרות מבנים mesomeric יותר כדי להשיג תהודה ייצוב של המדינה נרגשת. נקודות החיבור אל הגרדום FP מוצגים מלון. אנא לחץ כאן כדי להציג גירסה גדולה יותר של הדמות הזאת.

פתרון מניות ריכוז, הממס הערה
20% D-גלוקוז 200 גרם/L D-גלוקוז ddH2O לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
אינדול 50 מ מ ב אלכוהול איזופרופיל
4-אמינו-אינדול 50 מ מ 20% אתנול (20 מ"ל אתנול באמצעי אחסון הסופי של 100 מ ל התמלא ddH2O)
IPTG 1 מ' ב- ddH2O
L-טריפטופן 15 מ מ מומס ddH2O באמצעות 1 M HCl (להוסיף HCl dropwise תחת תוך ערבוב עד אבקת dissoved)
ליזוזים 50 מ"ג/מ"ל ב- ddH2O
DNase אני 1 מ"ג/מ"ל ב- ddH2O
RNase A 1 מ"ג/מ"ל ב- ddH2O
Amp100 אמפיצילין 100 מ"ג/מ"ל ב- ddH2O
נתרן-dodecylsulfate (מרחביות) 200 גרם/ליטר ב- ddH2O
. אמוניום סולפט ((NH4)2אז4) 1 מ' ב- ddH2O לחטא על ידי autoclaving
אשלגן פוספט dihydrogen (ח'2PO4) 1 מ' ב- ddH2O לחטא על ידי autoclaving
di-אשלגן פוספט (K2HPO4) 1 מ' ב- ddH2O לחטא על ידי autoclaving
מגנזיום גופרתי (MgSO4) 1 מ' ב- ddH2O לחטא על ידי autoclaving
D-גלוקוז 1 מ' ב- ddH2O לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
נתרן כלורי (NaCl) 5 מ' ב- ddH2O לחטא על ידי autoclaving
סידן כלורי (2CaCl) 1 g/L לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
iron(II) כלוריד (FeCl2) 1 g/L לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
תיאמין 10 גרם/ליטר לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
ביוטין 10 גרם/ליטר לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
שילוב יסודות קורט נחושת גופרתית (CuSO4), אבץ כלוריד (ZnCl2), מנגן כלורי (MnCl2), molybdate אמוניום ((NH4)2MoO4); כל 1 מ ג/ליטר ב- ddH2O לחטא על-ידי סינון דרך מסנן מזרק 0.45 µm גודל הנקבוביות
19 חומצות אמינו לערבב 1.) להמיס 0.5 g L-פנילאלנין ו- g 0.5 L-טירוזין ב- 100 מ ל ddH2O עם תוספת dropwise של HCl 1 מ' מתחת תוך ערבוב עד אבקה היא התפרקה.
2.) שוקלים החוצה 0.5 ג'י של כל חומצות אמינו L הנותרים (למעט L-טריפטופן). מערבבים עם 22 מ"ל fo 1 מ' ח'2PO4 ו- 48 מ"ל של 1 מ' K2HPO4. להוסיף ddH2O כ- 800 מ. ומערבבים עד הפתרון נעשה ברור.
3.) הוסף L-פנילאלנין מומס ו- L-טירוזין משלב 1.) ולכוונן את העוצמה כדי 1 ליטר עם ddH2O.
4.) Sterilize תערובת חומצות אמינו על-ידי סינון ואקום עם יחידת המסנן העליון בקבוק.
Buffers ו- Media הרכב/הכנה
מרחביות טעינת מאגר לצבוע, 5 x מרוכז 0.25 M טריס pH 6.8, 50% v/v גליצרול, 0.25% w/v bromphenol כחול, didhiothreitol 0.5 M (DTT; לחלופין 5% β-mercaptoethanol), 10% w/v נתרן-dodecylsulfate (מרחביות)
מאגר איגוד dihydrogenphosphate סודיום 50 מ מ (NaH2PO4), 500 מ מ NaCl, 10 מ מ imidazole, pH 8
• תנאי מאגר dihydrogenphosphate סודיום 50 מ מ (NaH2PO4), 500 מ מ NaCl, 250 מ מ imidazole, pH 8
מאגר דיאליזה dihydrogenphosphate סודיום 50 מ מ (NaH2PO4), 150 מ"מ NaCl, גליצרול 100 מ ל/L, pH 8
מאגר MS 10 מ מ טריס-HCl, pH 8
חדש בינונית מזערי המכיל 19 חומצות אמינו L חוץ L-טריפטופן (NMM19) לערבב את כל הפתרונות מניות כדי להשיג ריכוז סופי הבאים: 7.5 מ מ (NH4)2אז4, מ מ 1.7 NaCl, 22 מ מ ח'2PO4, 50 מ מ K-2-HPO-4, 1 מ MgSO4, 20 מ מ D-גלוקוז, 50 מ"ג/ליטר של לערבב 19 חומצות אמינו, µg/L 1 CaCl2, µg/L 1 FeCl2, 10 µg/L תיאמין, ביוטין 10 mg/L, שילוב יסודות קורט 0.01 מ"ג/ליטר
LB בינוני הרכב: טריפטון 10 גרם/ליטר, 5 g/L שמרים לחלץ, 10 גרם/ליטר NaCl, pH 7.0 ddH2O
הכנה:
1.) שוקל לצאת טריפטון 50 גרם, 25 גרם שמרים לחלץ, 5 g NaCl לתוך בקבוק זכוכית 1 ליטר.
2.) הוסף ddH2O עד ~ 800 מ ל ורכיבים התמוססות תחת ערבוב.
3.) למדידת pH ולהתאים את ה-pH 7 על-ידי חיבור dropwise 1 M HCl או 1 M NaOH, במידת הצורך. להוסיף ddH2O עד 1 ל'
4.) Sterilize על ידי autoclaving, לבדוק אובדן נפח לאחר מכן ולהוסיף ddH סטרילי2O לפצות במידת הצורך. לאחסן ב 4 ° C עד השימוש.
פלטות אגר ליברות הרכב: טריפטון 10 גרם/ליטר, 5 g/L שמרים לחלץ, 10 גרם/ליטר NaCl, 15 גר'/ליטר אגר אגר, pH 7.0 ddH2O
הכנה:
1.) שוקל לצאת טריפטון 50 גרם, 25 גרם שמרים לחלץ, 5 g NaCl, אגר אגר 7.5 גר' לתוך בקבוק זכוכית 1 ליטר.
2.) הוסף ddH2O עד 500 מ"ל ורכיבים התמוססות תחת ערבוב.
3.) למדידת pH ולהתאים את ה-pH 7 על-ידי חיבור dropwise 1 M HCl או 1 M NaOH, במידת הצורך. להוסיף ddH2O עד 1 ל'
4.) Sterilize על ידי autoclaving, לבדוק אובדן נפח לאחר מכן ולהוסיף ddH סטרילי2O כדי לפצות על כך, אם יש צורך בכך. (הערה: LB אגר שניתן לאחסן ב 4 ° C עד שימוש להכנת פלטות אגר ליברות. בזהירות להמיס אגר הקרושה באמצעות מיקרוגל)
5.) כאשר הפתרון הוא עדיין חמים (30-40 מעלות צלזיוס), להוסיף אמפיצילין ריכוז הסופי של µg 100/mL
6.) זרימה בערך 15 מ"ל של הנוזל משלב 5.) לתוך סטרילי 10 ס מ פטרי בתנאים סטריליים. כאשר אגר הוא פני השטח למוצק, ניתן לאחסן לוחות עבור שבוע 1-4 ° C עד השימוש.
באגירה פוספט תמיסת מלח (PBS) הרכב: 137 מ מ NaCl, מ מ 2.7 אשלגן כלורי, 10 מ מ נה2HPO4,2PO 1.8 מ מ ח'4, 1 מ"מ CaCl2, 0.5 מ מ MgCl2, pH 7. לחטא autoclaving או סינון.

טבלה 1: פתרון מניות, מאגר.

Discussion

כדי להשיג יעילות גבוהה מאוד של התאגדות המכללות, השיטה SPI מבוסס על auxotrophy מסתמך על השימוש של התאים המארחים מהונדסים סמויה, אשר אינם מסוגלים לסנתז לכנף טבעי המקביל של ncAA. עבור e. coli, זנים כאלה זמינים בקלות. אפילו סימולטני שיתוף ncAAs מרובים לתוך החלבון אותו הוא ריאלי באמצעות זנים multiauxotrophic. ניתן לראות את מצב ספציפי שאריות של החלפת ורפרטואר כימיים מוגבלת לחור תחליפי כימי דומה החסרונות. ובכל זאת, ניתן להפיק מספר גדול של גרסאות חלבון כמו המנגנון הטבעי תרגום חיידקי סובלנית תחליפי חומצת אמינו רבות. לדוגמה, ncAAs יותר מ-50 יכול לשלב חלבונים באמצעות במבחנה תרגום, והיוו כ- 73% של כל codons של הקוד הגנטי יהיה זמין עבור ההקצאה מחדש40. יתר על כן, SPI יכול גם לאפשר labelling ריבוי אתרים יעיל של חלבון המטרה41. בעקרון, המתודולוגיה SPI אינה מוגבלת e. coli, אך יכולים לעבוד מכל פונדקאי אחר, עבור כל אחד מחומצות האמינו הקנוני 20, ובלבד זנים auxotrophic ומדיה מוגדר טיפוח הינם זמינים. לדוגמה, שני תחליפי מתיונין, azidohomoalanine (Aha) ו homopropargylglycine (Hpg), הן מבחינה מסחרית זמינים משמש תיוג חלבונים ו proteomes אורגניזמים שונים. בנוסף, Aha יכול להיות מיוצר intracellularly, לאחר מכן שולב חלבון42. המכללות זה מתאים במיוחד bioorthogonal ההטיות כגון כימיה לחץ כפי שפותחה על ידי Tirrel ועמיתיו: לדוגמה, בצמח רקמות של תודרנית לבנה, הזחלים טוואי המשי 43, דרוזופילה תאים44, דג זברה זחל45 וכן בתרבית של תאים כולל נוירונים46, חלבונים יכולים להיות בלוחיות Aha47,48. באופן דומה, תחליפי Trp שולבו בהצלחה לתוך פפטידים מיקרוביאלית Trp-auxotrophic הכרוכים lactis זנים49. SPI שימושית גם עבור השדה של Xenobiology50,51, אשר בוחנת חלופות האיפור הכימית הבסיסית של החיים. לדוגמה, מבוסס על עבודות קודמות ב e. coli52 ו- B. subtilis53, זן e. coli פותחה לאחרונה על ידי אסטרטגיית אבולוציונית עם הלחץ הסלקטיבי לנצל את thienopyrrole במקום אינדול, וכתוצאה מכך פרוטאום ברוחב החלפה של טריפטופן על-ידי thienopyrrole-אלנין ב הקוד הגנטי54. באופן כללי, חומצת אמינו הקנוני ביותר Trp, אשר מקודד על ידי שלישיה יחיד (UGG), מציג מטרה מבטיח הנדסה חלבון בשל הצדדים עשיר של אינדול כימיה, אשר מציעה וריאציות כימיות רבות. לאחרונה, כחלופה מבוסס-SPI התאגדות, רומן SCS פלטפורמה מסוגל לשלב Trp תחליפי site-specifically ב hosts חיידקי והן האיקריוטים כבר דיווחו על55. זה עוד יותר מרחיבה את ארגז הכלים להנדסת ויוו חלבון מבוסס ncAA, כולל את שינוי של תכונות ספקטרליות.

מלבד השימוש בביטוי auxotrophic מארחים, פרוטוקול SPI דורש תנאים תסיסה קפדנית, מבחינת העיתוי ביטוי היעד ואת ההרכב של המדיום כדי להשיג יעילות גבוהה של התאגדות המכללות ועם תשואה חלבון המטרה 56. טיפוח מתבצע באמצעות מדיה מינימלי מוגדרים כימי, אשר למעשה מכילים מלבד מלחים הגדולות המקורות של חנקן (אמוניום מלח), פחמן (D-גלוקוז), ויטמינים ויסודות. אמנם לא הנדרשת בהיעדר עוד יותר auxotrophies, חומצות אמינו הנותרים (20 -n, אם חומצות אמינו n להחליפו) מתווספים בדרך כלל כדי לקדם את התפתחות חיידקים57. במהלך שלב הגדילה הראשונית לקראת הגיוס של ביטוי חלבון המטרה, מוסיפים את n הקנוני חומצות אמינו להחליפו הגבלת ריכוזים. צמיחה סלולרי ממשיך עד דלה של חומצות אמינו חיוניות יישוב, שמציין כמו השפעול יתר נייח600. לאחר מכן, המדיום תרבות מוחלף על ידי בינוני טריים חסרה חומצת אמינו מדולדל ביותר ומכיל ncAA בריכוזים בשפע. עבור שיתוף ribosomal תחליפי טריפטופן כפי שמוצג פרוטוקול זה, אינדול אנלוגי מוזן, אשר הופך intracellularly להמיר הנגזרת טריפטופן המתאימים על ידי טריפטופן סינתאז58. בשלב הבא, מושרה ביטוי חלבון המטרה. בשלב זה, התאים הם קרובים לסוף של גידול לוגריתמי, כמו איזון בין מספר התאים הכולל וכושר. הנוכחות ואת תיאגוד הקנוני אמינו יוביל ייצור החלבון פראי-סוג, זה קריטי כדי להבטיח כי חומצת אמינו חיונית ביותר תיגמר במלואו לפני הגיוס. באופן דומה, זה הכרחי כדי לבחון את היעילות של ncAA השתלבות החלבון היעד, בדרך כלל על ידי ספקטרומטר מסה במקרה של נוכחות משמעותית של החומצה אמינית הקנוני, טיפוח תנאים צורך להתאימם, למשל, על ידי שינוי ריכוז amino acid(s) חיוני לשלב הגידול הראשוני או את משך הזמן של האחרונים. במקרה של פעילות aaRS נמוך לכיוון ncAA, את ביטוי של האנזים אנדוגני או ביטוי משותף של aaRS שונים, אשר פעיל יותר לכיוון ncAA, יכול להיות מתנהל59.

חומצת אמינו הקנוני ביותר Trp ניחן שלוש תכונות יוצא דופן: (i) השפע הטבעי שלה בחלבונים הוא נמוך; (ii) תכונותיו הביו-פיסיקלי וכימי הם ייחודיים (למשל., זה בדרך כלל המקור הדומיננטי של זריחה מהותי של חלבונים, פפטידים), וכן (iii) זה תורם למגוון רחב של אינטראקציות הביוכימי ופונקציות כולל Π-לערום, שטני של H וπ הקטיון אינטראקציות. כל התכונות הללו משתנים באופן קיצוני עם Trp → 4-אמינו-Trp החלפת ספק GdFP-מעבר, העיצוב של מחלקה "זהב" של avGFPs הוא דוגמא נפלאה עבור הנדסה חלבונים autofluorescent בהתאמה אישית. עם תכונות ספקטרליות ברורים, FPs ניתן יהיה מכוון כלפי windows ספקטרלי מסוים באמצעות התאגדות מוטגנזה מכוונת ו- ncAA. במקרה של GdFP, זו מושגת על ידי כימי חילופי פשוטים H ← NH2 במסגרת הזירה אינדול הכלול הטראיידים כרומופור ECFP. איור 5 מציג את ההשפעות של ncAA לצאר כרומופור. כניסתה של הקבוצה תורם אלקטרון שמקורם 4-אמינו-אינדול (המרה intracellularly 4-אמינו-Trp) מאפשר מגוון רחב של מבנים mesomeric יכול להסביר מצב נרגש מיוצב. . Spectroscopically, shift סטוקס מוגדלת שלה ואת פליטת קרינה פלואורסצנטית אדום-העביר כתוצאה אלה מאפיינים ברורים של מערכת מצומדת המורחבת. כפי שדווח קודם לכן, העברת תשלום התפלגות משופרת בתוך כרומופור GdFP רגישה מטבעו pH (איור 4B) ומלווה על ידי שינוי גדול יותר מומנט דיפול בין קרקע0 S S1 מתרגש המדינה יחסית ECFP33. כמו קבוצות אלקטרונים-תרומת חלופיים, תחליפי טריפטופן הנושאת טבעת אינדול שהוחלפו עם קבוצות הידרוקסי יכול לשמש, כפי שדווח במחקר השוואתי עם דגם חלבון barstar41.

ספקטרום קרינה פלואורסצנטית ורפואה של GdFP והפשטה בהשוואה ל- ECFP ו- EGFP (איור 3C ו- D). הומוגניות הרחבת הלהקות ורפואה פלורסצנטיות נגרמת בדרך כלל על-ידי הלטראלית ב כרומופור ועל, בנוסף, על ידי זיווג כרומופור כדי עוד יותר נוכח ה חלבון60הלטראלית. המושבים לסביבה המקומית חלבון נתמך על ידי חיובים מקומי על כרומופור. כמו inhomogeneity מבנית של החלבון מוביל לווריאציות המקומי של הספקטרום vibronic, כזה צימוד בין ספקטרום vibronic של כרומופור שאר החלבון נתמכים על ידי תשלום delocalization ומדינות mesomeric כפי שמצוין איור 5. צימוד זה תומך גם משמרת סטוקס גדול ומקטינה בהכרח את התשואה הקוונטית של קרינה פלואורסצנטית. לעומת אחרים אדום-העביר FPs, GdFP אפילו תערוכות יציבות משופרת חלבון, נטייה נמוכה צבירת-33,-61,-62. זה לא רק שונה מצבע גרסאות אחרות FP אלא גם תערוכות של thermostability מוגבר באופן משמעותי, קואופרטיב משופרת קיפול33. עוצמת קרינה פלואורסצנטית שלו הוא לפחות 90% נשמר בעת חימום עד 60 ° צלזיוס, בעוד ECFP זריחה מופחתת ל- 30%. בחלבונים, חומצות אמינו ארומטיות לתרום לעיתים קרובות רשתות של שרשראות צד אינטראקציה, אשר בדרך כלל השפעה ייצוב על מבנה שלישוני של החלבון. avGFP בנמלים כזה בצד רשת רשת, אשר מורכב כרומופור עצמו, כמו גם כמו Phe-165, שלו-148, טיר-145. שרשראות צד אלו אינם רק די מאובנות של מבנה GdFP33, אך חשוב מכך, הם יוצרים קשרים הידרופוביות עם כרומופור. התכונה הבולטת ביותר הרומן שתוארה GdFP הוא כרומופור aminated הוא יותר קרובים כדי Phe-165. אינטראקציה זו היא תכונה לא נצפתה avGFPs ידועים אחרים. כפי משקעי שני 3.2-4.5 Å בנפרד, אמינו-ארומטי אינטראקציות יכול להיות גם בהווה. יחד עם amination-induced תהודה ייצוב כרומופור, אלה ככל הנראה ייצוב רשת הידרופובי זו של חומצות אמינו בצורה שיתופית. העברה התפלגות מטען יעיל יותר עשוי להיות נתמך על ידי אינטראקציות אלה במדינת נרגש לעומת מצב הקרקע של כרומופור, זה לפחות לנצילות 108 nm סטוקס shift33,62 .

בתכנון הרציונלי של מאפיינים fluorophore, גידול בגודל של המערכת-π מאותרים הוא חזה את התוצאה עירור אדום-העביר אורך גל. הכלל של האגודל היא צייתה על ידי הסדרה של חומצות אמינו ב המוביל 66 עמדה נייטרלית בראשון: Phe (λמקסימום = 355 ננומטר) < שלו (λאמא x= 386 ננומטר) < טיר (λמקסימום = 395 ננומטר) < Trp (λמקסימום = 436 ננומטר)63. בטבע, הרחבה זו של כרומופור מערכת מצומדת של π-חוב הושג בזכות אסטרטגיות שונות. עבור DsRed של Discosoma מסורטטת, זה מורחב על ידי השילוב של חומצת אמינו נוספות, ובכך הסטה λמקסימום ל- 573 nm64. כרומופור של asFP595 (λמקסימום = 595 nm) מ Anemonia סאלכאטה הוארך על ידי קבוצת imino, הגדלת שלה π-מערכת65. מאז כרומופור של GdFP ו avFPs אחרים היא בגודל זהה, עיקרון שונה חייב כרוכה של גל פליטה בטווח של DsRed מורחבת, הן asFP595. משמרת סטוקס עמוקה של 108 nm מיוחס למבנה ברורים כרומופור GdFP, אשר חושף את עיקרון photophysical חדש בעיצוב של חלבונים autofluorescent. החישובים ראשוני (כפי שדווח ב- 62) הראו כי מומנט דיפול של כרומופור המדינה נרגשת של GdFP הוא גדול באופן משמעותי יותר במצב הקרקע, בניגוד הערכים המתאימים של ECFP. ואילו מומנט דיפול של GdFP עולה מ ~ 3 D (דביי) במצב0 S ל ~ 15 D S1, השינוי כרומופור ECFP היו מתונות למדי (מ ד ~ 4 ~ 6 D). לפיכך, קרינה פלואורסצנטית הזהב הייחודי של GdFP נגרמת על ידי העברת תשלום התפלגות משמעותית בתוך כרומופור, אשר מגדיל את מגוון מבנים אפשריים mesomeric (ראה איור 5) המאפשרים תהודה מייצב. זה מפחית את רמת האנרגיה שממנו מתרחשת פליטה. בעקבות שינוי מעמיק מומנט דיפול על עירור, ההפרדה תשלום התפלגות היא הסיבה העיקרית עבור שינויי פוטנציאל אלקטרוסטטית של הסביבה כרומופור. מטריקס חלבון שמסביב, בתורו, מתאים לשינויים בחלוקת תשלום לאחר כרומופור עירור. הרפיה מבניים הבאים מוריד את רמת האנרגיה של כרומופור נרגש, אשר משמרות את ספקטרום קרינה פלואורסצנטית לאדום בשל אופיו העברת תשלום. עבור מאותה סיבה, כתוצאה shift סטוקס גדול ומחירים משופרת של תהליכים radiationless, התשואה קוונטית זריחה של GdFP מצטמצם לעומת ECFP33.

תשואה גבוהה קוונטית ותזוזה סטוקס קטן של ECFP ושל EGFP מיוחסים בדרך כלל סביבה חלבונים נוקשה של כרומופור, אשר מפחית את דרגות החופש, וכתוצאה מכך קונברסיה פנימית לטובת הרפיה קרינה של המדינה נרגשת 66. כתוצאה מכך, העיצוב מולקולרית של הן יותר נוקשה מוטבעים עם צימוד מופחתת אל המטריקס חלבונים הנותרים יוכלו לשמש כמדריך לייצר עוד אדום-העביר GFP נגזרים עם פלורסצנטיות גבוהה קוונטית התשואה. לכן, עבור עוד יותר הנדסה גישות לייצר חלבונים autofluorescent אדום-העביר, הגדלה של המערכת π אלקטרונים, מבנה כרומופור נוקשה עם חלש זיווגים לסביבה חלבון הוא רצוי מאוד. גם יכול להיות הציג שינויים אלה ישירות לתוך מבוסס-GFP בראשון או על-ידי הצבת ncAAs הרצוי בסביבה כרומופור.

Disclosures

המחברים מצהירים כי יש להם אינטרסים כלכליים אין מתחרים.

Acknowledgments

עבודה זו נתמך על ידי הגרמני מחקר קרן (מקבץ של מצוינות "המאחד מושגים ב זרז) טי, כמו גם על ידי משרד החינוך הפדרלי המדע (BMBF תוכנית"HSP 2020", TU-WIMIplus פרוייקט SynTUBio) לפ-י. ס

Materials

Name Company Catalog Number Comments
Chemicals
4-aminoindole Sigma-Aldrich 525022
acetonitrile VWR HiPerSolv CHROMANORM ULTRA for LC-MS, 83642 LC-MS grade required
agar-agar Carl Roth 5210
ammonium molybdate ((NH4)2MoO4) Sigma-Aldrich 277908
ammonium sulfate ((NH4)2SO4) Sigma-Aldrich A4418
ampicillin sodium salt Carl Roth K029
biotin Sigma-Aldrich B4501
bromophenol blue Sigma-Aldrich B0126
calcium chloride (CaCl2) Sigma-Aldrich C5670
colloidal silica Sigma-Aldrich Ludox HS-40, 420816
Coomassie Brillant Blue R 250 Carl Roth 3862
copper sulfate (CuSO4) Carl Roth CP86.1
D-glucose Carl Roth 6780
di-sodium hydrogen phosphate (Na2HPO4) Carl Roth X987
di-potassium hydrogen phosphate (K2HPO4) Carl Roth P749.1
1,4-dithiothreitol (DTT) Carl Roth 6908
DNase I Sigma-Aldrich D5025
ethanol Carl Roth 9065.1
formic acid VWR HiPerSolv CHROMANORM for LC-MS, 84865 LC-MS grade required
glycerol Carl Roth 3783
imidazole Carl Roth X998
indole Sigma-Aldrich I3408
iron(II) chloride (FeCl2) Sigma-Aldrich 380024
isopropanol Carl Roth AE73.1
isopropyl β-D-1-thiogalactopyranoside (IPTG) Sigma-Aldrich I6758
lysozyme Sigma-Aldrich L6876
magnesium chloride (MgCl2) Carl Roth KK36.1
magnesium sulfate (MgSO4) Carl Roth 8283.2
manganese chloride (MnCl2) Sigma-Aldrich 63535
β-mercaptoethanol Carl Roth 4227.3
potassium chloride (KCl) Carl Roth 6781.3
potassium dihydrogen phosphate (KH2PO4) Sigma-Aldrich P5655
RNase A Carl Roth 7156
sodium chloride (NaCl) Carl Roth P029
sodium dihydrogen phosphate (NaH2PO4) Carl Roth T879
sodium dodecyl sulphate (NaC12H25SO4) Carl Roth 0183
thiamine Sigma-Aldrich T4625
Tris(hydroxymethyl)-aminomethane (Tris) Carl Roth 5429
Tris hydrochloride (Tris-HCl) Sigma-Aldrich 857645
tryptone Carl Roth 8952
yeast extract Carl Roth 2363
zinc chloride (ZnCl2) Sigma-Aldrich 229997
Name Company Catalog Number Comments
amino acids
L-alanine Sigma-Aldrich A7627
L-arginine Sigma-Aldrich A5006
L-asparagine Sigma-Aldrich A8381
L-aspartic acid Sigma-Aldrich A0884
L-cysteine Sigma-Aldrich C7352
L-glutamic acid Sigma-Aldrich G2128
L-glutamine Sigma-Aldrich G3126
L-glycine Sigma-Aldrich G7126
L-histidine Sigma-Aldrich H8000
L-isoleucine Sigma-Aldrich I2752
L-leucine Sigma-Aldrich L8000
L-lysine Sigma-Aldrich L5501
L-methionine Sigma-Aldrich M9625
L-proline Sigma-Aldrich P0380
L-phenylalanine Sigma-Aldrich P2126
L-serine Sigma-Aldrich S4500
L-threonine Sigma-Aldrich T8625
L-tryptophan Sigma-Aldrich T0254
L-tyrosine Sigma-Aldrich T3754
L-valine Sigma-Aldrich V0500
Name Company Catalog Number Comments
Lab materials
0.45 µm syringe filter with PVDF membrane Carl Roth CCY1.1
1.5 mL microcentrifuge tubes Eppendorf 30120086
conical polystyrene (Falcon) tubes, 50 mL Fisher Scientific 14-432-22
Luer-Lock syringe 5 mL Carl Roth EP96.1
dialysis membrane, Molecular Weight Cut-Off (MWCO) 5,000 Spectrum Medical Industries Spectra/Por MWCO 5000 dialysis membrane, 133198
Immobilized Metal ion Affinity Chromatography (IMAC) column 1 mL, Ni-NTA Macherey Nagel Protino series, 745410.5
petri dishes (polystyrene, sterile) Carl Roth TA19
pQE-80L plasmid vector Qiagen no longer available replaced by N-terminus pQE Vector set Cat No./ID: 32915
protein extraction reagent BugBuster EMB Millipore 70921-4
round-bottom polystyrene tubes, 14 mL Fisher Scientific Corning Falcon, 14-959-1B
Trp-auxotrophic E. coli strain ATCC ATCC 49980 Bridges BA et al., Chem Biol Interact., 1972, 5(2):77-84; see main text for alternatives
Name Company Catalog Number Comments
Mass Spectrometry equipment
mass spectrometer for LC-ESI-TOF-MS Agilent Agilent 6530 Accurate-Mass QTOF coupled with Infinity LC system
mass spectrometry data analysis software Agilent MassHunter Qualitative Analysis software v. B.06.00
High-Performance Liquid Chromatography (HPLC) column for LC-ESI-TOF-MS Sigma-Aldrich Supelco Discovery BIO Wide Pore C5 HPLC column, 3 µm particle size, 10 cm x 2.1 mm
HPLC autosampler vials 1.5 mL Sigma-Aldrich Supelco 854165 with conical 0.1 mL glass inserts, screw caps and septa
Name Company Catalog Number Comments
General equipment
benchtop centrifuge for 1.5 mL Eppendorf tubes Eppendorf 5427 R
cooling centrifuge for 50 mL Falcon tubes Eppendorf 5810 R
high pressure microfluidizer for bacterial cell disruption Microfluidics LM series with “Z” type chamber
peristaltic pump for LC GE Healthcare P-1
Fast Protein Liquid Chromatography (FPLC) system GE Healthcare ÄKTA pure 25 L
orbital shaker for bacterial cultivation Infors HT Minitron
UV/Vis spectrophotometer Biochrom ULTROSPEC 2100
ultrasonic homogenizer for bacterial cell disruption Omnilab Bandelin SONOPULS HD 3200, 5650182 with MS72 sonifier tip
Name Company Catalog Number Comments
Fluorescence spectroscopy equipment
ps-pulsed laser 470 nm Picoquant GmbH PDL-470
time- and wavelength-correlated single photon counting (TWSPC) acquisition software Picoquant GmbH SymPhoTime 64
time- and wavelength-correlated single photon counting (TWSPC) detector Picoquant GmbH PML-16C 16 spectral channels, to be selected by grating settings
single photon counting software Picoquant GmbH SPCM 9.75
global fitting software Picoquant GmbH SPC2Glo(R)
fluorescence decay data analysis software Picoquant GmbH FluoFit program
data analysis software OriginLab Inc. Origin 9.2
neutral density filter set Schott NG1 to NG11 (400 - 650 nm, transmission 50 %, 20%, 10 %, 5 %)
488 nm long-pass emission filter AHF Analysentechnik AHF-488
quartz cuvette Thorlabs GmbH CV10Q1400 1 cm pathlength

DOWNLOAD MATERIALS LIST

References

  1. Shimomura, O., Johnson, F. H., Saiga, Y. Extraction, Purification and Properties of Aequorin, a Bioluminescent Protein from the Luminous Hydromedusan, Aequorea. J Cell Compar Physl. 59, (3), 223-239 (1962).
  2. Chalfie, M., Tu, Y., Euskirchen, G., Ward, W. W., Prasher, D. C. Green fluorescent protein as a marker for gene expression. Science. 263, (5148), 802-805 (1994).
  3. Andresen, M., et al. Structure and mechanism of the reversible photoswitch of a fluorescent protein. P Natl Acad Sci USA. 102, (37), 13070-13074 (2005).
  4. Andresen, M., et al. Structural basis for reversible photoswitching in Dronpa. P Natl Acad Sci USA. 104, (32), 13005-13009 (2007).
  5. Brakemann, T., et al. A reversibly photoswitchable GFP-like protein with fluorescence excitation decoupled from switching. Nat Biotechnol. 29, (10), 942-947 (2011).
  6. Kremers, G. -J., Gilbert, S. G., Cranfill, P. J., Davidson, M. W., Piston, D. W. Fluorescent proteins at a glance. J Cell Sci. 124, (Pt 2), 157-160 (2011).
  7. Shimomura, O. Structure of the chromophore of aequorea 0. shimomura green fluorescent protein. FEBS Lett. 104, (2), 220-222 (1979).
  8. Shaner, N. C., Campbell, R. E., Steinbach, P. A., Giepmans, B. N. G., Palmer, A. E., Tsien, R. Y. Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein. Nat Biotechnol. 22, (12), 1567-1572 (2004).
  9. Shcherbo, D., et al. Bright far-red fluorescent protein for whole-body imaging. Nat Methods. 4, (9), 741-746 (2007).
  10. Shcherbakova, D. M., Subach, O. M., Verkhusha, V. V. Red fluorescent proteins: advanced imaging applications and future design. Angew Chem Int Edit. 51, (43), 10724-10738 (2012).
  11. Stepanenko, O. V., Verkhusha, V. V., Kuznetsova, I. M., Uversky, V. N., Turoverov, K. K. Fluorescent proteins as biomarkers and biosensors: throwing color lights on molecular and cellular processes. Curr Protein Pept Sc. 9, (4), 338-369 (2008).
  12. Wang, L., Xie, J., Deniz, A. A., Schultz, P. G. Unnatural amino acid mutagenesis of green fluorescent protein. J Org Chem. 68, (1), 174-176 (2003).
  13. Budisa, N., Steipe, B., Demange, P., Eckerskorn, C., Kellermann, J., Huber, R. High-level biosynthetic substitution of methionine in proteins by its analogs 2-aminohexanoic acid, selenomethionine, telluromethionine and ethionine in Escherichia coli. Eur J Biochem. 230, (2), 788-796 (1995).
  14. Sharma, N., Furter, R., Kast, P., Tirrell, D. A. Efficient introduction of aryl bromide functionality into proteins in vivo. FEBS Lett. 467, (1), 37-40 (2000).
  15. Liu, C. C., Schultz, P. G. Adding new chemistries to the genetic code. Annu Rev Biochem. 79, 413-444 (2010).
  16. Twine, S. M., Murphy, L., Phillips, R. S., Callis, P., Cash, M. T., Szabo, A. G. The Photophysical Properties of 6-Azaindole. J Phys Chem B. 107, (2), 637-645 (2003).
  17. Lepthien, S., Hoesl, M. G., Merkel, L., Budisa, N. Azatryptophans endow proteins with intrinsic blue fluorescence. P Natl Acad Sci USA. 105, (42), 16095-16100 (2008).
  18. Budisa, N., et al. Probing the role of tryptophans in Aequorea victoria green fluorescent proteins with an expanded genetic code. Biol Chem. 385, (2), 191-202 (2004).
  19. Ross, J. B., et al. Spectral enhancement of proteins: biological incorporation and fluorescence characterization of 5-hydroxytryptophan in bacteriophage lambda cI repressor. P Natl Acad Sci USA. 89, (24), 12023-12027 (1992).
  20. Soumillion, P., Jespers, L., Vervoort, J., Fastrez, J. Biosynthetic incorporation of 7-azatryptophan into the phage lambda lysozyme: Estimation of tryptophan accessibility, effect on enzymatic activity and protein stability. Protein Eng Des Sel. 8, (5), 451-456 (1995).
  21. Heim, R., Tsien, R. Y. Engineering green fluorescent protein for improved brightness, longer wavelengths and fluorescence resonance energy transfer. Curr Biol. 6, (2), 178-182 (1996).
  22. Bridges, B. A., Mottershead, R. P., Rothwell, M. A., Green, M. H. L. Repair-deficient bacterial strains suitable for mutagenicity screening: tests with the fungicide captain. Chem Biol Interact. 5, (2), 77-84 (1972).
  23. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Bacterial Transformation: The Heat Shock Method. J Vis Exp. (2017).
  24. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Bacterial Transformation: Electroporation. J Vis Exp. (2017).
  25. Grigorenko, B. L., Krylov, A. I., Nemukhin, A. V. Molecular modeling clarifies the mechanism of chromophore maturation in the green fluorescent protein. J Am Chem Soc. (2017).
  26. JoVE Science Education Database. General Laboratory Techniques. Introduction to the Spectrophotometer. J Vis Exp. (2017).
  27. Goedhart, J., et al. Structure-guided evolution of cyan fluorescent proteins towards a quantum yield of 93%. Nat Commun. 3, 751 (2012).
  28. Neidhardt, F. C., Bloch, P. L., Smith, D. F. Culture medium for enterobacteria. J Bacteriol. 119, (3), 736-747 (1974).
  29. Hörnsten, E. G. On culturing Escherichia coli on a mineral salts medium during anaerobic conditions. Bioprocess Eng. 12, (3), 157-162 (1995).
  30. Davis, B. D. The Isolation of Biochemically Deficient Mutants of Bacteria by Means of Penicillin. P Natl Acad Sci USA. 35, (1), 1-10 (1949).
  31. Sambrook, J., Russell, D. W. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press. Cold Spring Harbor, NY, USA. (2001).
  32. Wang, Y. -S., et al. The de novo engineering of pyrrolysyl-tRNA synthetase for genetic incorporation of L-phenylalanine and its derivatives. Mol Biosyst. 7, (3), 714-717 (2011).
  33. Bae, J. H., et al. Expansion of the genetic code enables design of a novel "gold" class of green fluorescent proteins. J Mol Biol. 328, (5), 1071-1081 (2003).
  34. JoVE Science Education Database. Dialysis: Diffusion Based Separation. J Vis Exp. Cambridge, MA. (2017).
  35. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Separating Protein with SDS-PAGE. J Vis Exp. (2017).
  36. Petrásek, Z., et al. Excitation energy transfer from phycobiliprotein to chlorophyll d in intact cells of Acaryochloris marina studied by time- and wavelength-resolved fluorescence spectroscopy. Photoch Photobio Sci. 4, (12), 1016-1022 (2005).
  37. Kolber, Z. S., Barkley, M. D. Comparison of approaches to the instrumental response function in fluorescence decay measurements. Anal Biochem. 152, (1), 6-21 (1986).
  38. Pelet, S., Previte, M. J. R., Laiho, L. H., So, P. T. C. A fast global fitting algorithm for fluorescence lifetime imaging microscopy based on image segmentation. Biophys J. 87, (4), 2807-2817 (2004).
  39. Loefroth, J. E. Time-resolved emission spectra, decay-associated spectra, and species-associated spectra. J Phys Chem. 90, (6), 1160-1168 (1986).
  40. Hartman, M. C. T., Josephson, K., Lin, C. -W., Szostak, J. W. An expanded set of amino acid analogs for the ribosomal translation of unnatural peptides. PLoS One. 2, (10), e972 (2007).
  41. Budisa, N., et al. Global replacement of tryptophan with aminotryptophans generates non-invasive protein-based optical pH sensors. Angew Chem Int Edit. 41, (21), 4066-4069 (2002).
  42. Ma, Y., Biava, H., Contestabile, R., Budisa, N., di Salvo, M. L. Coupling bioorthogonal chemistries with artificial metabolism: intracellular biosynthesis of azidohomoalanine and its incorporation into recombinant proteins. Molecules. 19, (1), 1004-1022 (2014).
  43. Teramoto, H., Kojima, K. Incorporation of Methionine Analogues Into Bombyx mori Silk Fibroin for Click Modifications. Macromol Biosci. 15, (5), 719-727 (2015).
  44. Deal, R. B., Henikoff, J. G., Henikoff, S. Genome-wide kinetics of nucleosome turnover determined by metabolic labeling of histones. Science. 328, (5982), 1161-1164 (2010).
  45. Hinz, F. I., Dieterich, D. C., Tirrell, D. A., Schuman, E. M. Non-canonical amino acid labeling in vivo to visualize and affinity purify newly synthesized proteins in larval zebrafish. ACS Chem Neurosci. 3, (1), 40-49 (2012).
  46. Dieterich, D. C., et al. In situ visualization and dynamics of newly synthesized proteins in rat hippocampal neurons. Nat Neurosci. 13, (7), 897-905 (2010).
  47. Dieterich, D. C., Link, A. J., Graumann, J., Tirrell, D. A., Schuman, E. M. Selective identification of newly synthesized proteins in mammalian cells using bioorthogonal noncanonical amino acid tagging (BONCAT). P Natl Acad Sci USA. 103, (25), 9482-9487 (2006).
  48. Glenn, W. S., et al. Bioorthogonal Noncanonical Amino Acid Tagging (BONCAT) Enables Time-Resolved Analysis of Protein Synthesis in Native Plant Tissue. Plant Physiol. 173, (3), 1543-1553 (2017).
  49. Zhou, L., et al. Incorporation of tryptophan analogues into the lantibiotic nisin. Amino Acids. 48, (5), 1309-1318 (2016).
  50. Acevedo-Rocha, C. G., Budisa, N. Xenomicrobiology: a roadmap for genetic code engineering. Microb Biotechnol. 9, (5), 666-676 (2016).
  51. Agostini, F., Völler, J. -S., Koksch, B., Acevedo-Rocha, C. G., Kubyshkin, V., Budisa, N. Biocatalysis with Unnatural Amino Acids: Enzymology Meets Xenobiology. Angew Chem Int Edit. 56, (33), 9680-9703 (2017).
  52. Bacher, J. M., Ellington, A. D. Selection and characterization of Escherichia coli variants capable of growth on an otherwise toxic tryptophan analogue. J Bacteriol. 183, (18), 5414-5425 (2001).
  53. Wong, J. T. Membership mutation of the genetic code: loss of fitness by tryptophan. Pc Natl Acad Sci USA. 80, (20), 6303-6306 (1983).
  54. Hoesl, M. G., et al. Chemical Evolution of a Bacterial Proteome. Angew Chem Int Edit. 54, (34), 10030-10034 (2015).
  55. Italia, J. S., et al. An orthogonalized platform for genetic code expansion in both bacteria and eukaryotes. Nat Chem Biol. 13, (4), 446-450 (2017).
  56. Völler, J. -S., Thi To, T. M., Biava, H., Koksch, B., Budisa, N. Global substitution of hemeproteins with noncanonical amino acids in Escherichia coli with intact cofactor maturation machinery. Enzyme Microb Tech. 106, 55-59 (2017).
  57. Budisa, N., Steipe, B., Demange, P., Eckerskorn, C., Kellermann, J., Huber, R. High-level biosynthetic substitution of methionine in proteins by its analogs 2-aminohexanoic acid, selenomethionine, telluromethionine and ethionine in Escherichia coli. Eur J Biochem. 230, (2), 788-796 (1995).
  58. Völler, J. -S., Budisa, N. Coupling genetic code expansion and metabolic engineering for synthetic cells. Curr Opin Biotech. 48, 1-7 (2017).
  59. Johnson, J. A., Lu, Y. Y., Van Deventer, J. A., Tirrell, D. A. Residue-specific incorporation of non-canonical amino acids into proteins: recent developments and applications. Curr Opin Chem Biol. 14, (6), 774-780 (2010).
  60. Somsen, O. J., van Grondelle, R., van Amerongen, H. Spectral broadening of interacting pigments: polarized absorption by photosynthetic proteins. Biophys J. 71, (4), 1934-1951 (1996).
  61. Kurschus, F. C., Pal, P. P., Bäumler, P., Jenne, D. E., Wiltschi, B., Budisa, N. Gold fluorescent annexin A5 as a novel apoptosis detection tool. Cytom Part A. 75, (7), 626-633 (2009).
  62. Lepthien, S., Wiltschi, B., Bolic, B., Budisa, N. In vivo engineering of proteins with nitrogen-containing tryptophan analogs. Appl Microbiol Biot. 73, (4), 740-754 (2006).
  63. Wachter, R. M., Elsliger, M. -A., Kallio, K., Hanson, G. T., Remington, S. J. Structural basis of spectral shifts in the yellow-emission variants of green fluorescent protein. Structure. 6, (10), 1267-1277 (1998).
  64. Verkhusha, V. V., Lukyanov, K. A. The molecular properties and applications of Anthozoa fluorescent proteins and chromoproteins. Nat Biotechnol. 22, (3), 289-296 (2004).
  65. Martynov, V. I., Savitsky, A. P., Martynova, N. Y., Savitsky, P. A., Lukyanov, K. A., Lukyanov, S. A. Alternative cyclization in GFP-like proteins family. The formation and structure of the chromophore of a purple chromoprotein from Anemonia sulcata. J Biol Chem. 276, (24), 21012-21016 (2001).
  66. Piatkevich, K. D., Malashkevich, V. N., Morozova, K. S., Nemkovich, N. A., Almo, S. C., Verkhusha, V. V. Extended Stokes shift in fluorescent proteins: chromophore-protein interactions in a near-infrared TagRFP675 variant. Sci Rep. 3, (1), 1847 (2013).

Comments

0 Comments


    Post a Question / Comment / Request

    You must be signed in to post a comment. Please or create an account.

    Usage Statistics