Intercellulaire Ca<sup> 2 +</sup>-Golven worden gedreven door gap junctie kanalen als hemikanalen. Hier beschrijven we een methode om intracellulaire Ca meten<sup> 2 +</sup>-Golven in celmonolagen in reactie op een lokale eencellige mechanische stimulus en de toepassing ervan op de eigenschappen en de regulering van de gap junction kanalen en hemikanalen onderzoeken.
Intercellulaire communicatie is essentieel voor de coördinatie van fysiologische processen tussen cellen in diverse organen en weefsels zoals de hersenen, lever, retina, cochlea en vaatstelsel. In experimentele opstellingen, intracellulaire Ca2 +-golven worden opgewekt door een mechanische prikkel een enkele cel. Dit leidt tot de afgifte van de intracellulaire signalerende moleculen IP3 en Ca2 + die de voortplanting van de Ca 2 +-golf inleiding concentrisch van de mechanisch gestimuleerde cel om de naburige cellen. De belangrijkste moleculaire pathways die intercellulaire Ca2 +-golven controle worden geleverd door gap junction kanalen via de rechtstreekse overdracht van IP-3 en door hemikanalen door het vrijkomen van ATP. Identificatie en karakterisering van de eigenschappen en de regelgeving van de diverse connexin en pannexin isovormen als gap junction kanalen en hemikanalen zijn toegestaan door de quantification van de verspreiding van de intercellulaire Ca 2 +-golf, siRNA, en het gebruik van remmers van gap junction kanalen en hemikanalen. Hier beschrijven we een methode om intracellulaire Ca2 +-golf in monolagen van primaire corneale endotheliale cellen met Fluo4-vm in antwoord op een gecontroleerde en gelokaliseerde mechanische stimulus veroorzaakt door een acuut en kortdurend vervorming van de cel te meten als gevolg het aanraken van de celmembraan met een micromanipulator gecontroleerde glazen micropipet met een tip diameter van minder dan 1 urn. Ook beschrijven de isolatie van primaire boviene corneale endotheelcellen en het gebruik ervan als modelsysteem voor Cx43 hemichannel activiteit uitoefent als de aangedreven kracht intracellulaire Ca 2 +-golven door het vrijkomen van ATP. Tenslotte bespreken we het gebruik, voordelen, beperkingen en alternatieven van deze werkwijze in het kader van gap junction kanaal en hemichannel onderzoek.
Intercellulaire communicatie en signalering zijn essentieel voor de coördinatie van fysiologische processen in reactie op extracellulaire agonisten op weefsel en hele-orgaan level 1,2. De meest directe manier intercellulaire communicatie wordt door het optreden van gap junctions. Gap junctions zijn plaquettes van gap junction kanalen, die eiwitachtige kanalen gevormd door de head-to-head couperen van twee connexine (Cx) hemichannels van aangrenzende cellen 3,4 (figuur 1) zijn. Gap junctions doorlaten kleine signaalmoleculen met een molecuulgewicht van minder dan 1,5 kDa, zoals Ca2 + of IP 3 5, waardoor modulerende Ca2 +-afgifte uit de intracellulaire opslagplaatsen van de naburige cellen 6 (figuur 2). Gap junction kanalen zijn strak gereguleerd door intra-en intermoleculaire eiwit interacties en door cellulaire signalering processen, zoals redox wijziging enfosforylering 7. GJS vergemakkelijken de gecoördineerde respons van de aangesloten cellen, waardoor die als een chemische en elektrische syncytium. Bijvoorbeeld, de verspreiding van cardiale actiepotentiaal in de atriale en ventriculaire myocyten wordt gemedieerd door Cx-based GJ kanalen 85. Cxs niet alleen een rol van gap junction kanalen, maar ook vormen ongepaarde hemichannels, daardoor functioneren als kanalen in membranen eveneens regelmatig ionenkanalen 8-10 (Figuur 1). Hemichannels deelnemen aan paracrienen tussen naburige cellen door het regelen van de uitwisseling van ionen en signaalmoleculen tussen de intra-en extracellulaire milieu.
In veel celtypen (zoals epitheelcellen, osteoblasten, astrocyten, endotheelcellen, enz.) en organen (zoals de hersenen, de lever, de retina, cochlea en het vaatstelsel), intercellulaire Ca2 +-golven zijn fundamenteel voor de coördinatie van meercellige reacties <sup> 11. Verhogingen van de intracellulaire Ca2 + niveaus in een bepaalde cel zijn niet beperkt tot deze cel, maar doorgeven aan de omringende naburige cellen is, zodat de intracellulaire Ca 2 +-wave 12,13. Deze intercellulaire Ca2 +-golven zijn belangrijk voor de normale fysiologische regulering cellagen als syncytia en de dysregulatie is geassocieerd met pathofysiologische processen 11. In de hoornvliesendotheel en epitheel, verschillende groepen 14-24, inclusief onze eigen 25-33, bestudeerde de mechanismen en de rol van intercellulaire communicatie. In niet-exciteerbare cellen, zoals corneale endotheelcellen, twee verschillende modi van intercellulaire communicatie plaatsvinden 28,29, namelijk spleetovergangen intercellulaire communicatie en paracriene intercellulaire communicatie. Spleetovergangen intercellulaire communicatie impliceert een directe uitwisseling van signaalmoleculen via gap junctions 7. Gap juncnale intercellulaire communicatie is van cruciaal belang voor het behoud van weefsel homeostase, het regelen van celproliferatie, en de oprichting van een gesynchroniseerde reactie op extracellulaire spanning 10,34,35. In een aantal pathologieën, wordt gap junction koppeling verminderd als gevolg van gebrekkige Cxs, en hierbij van invloed spleetovergangen intercellulaire communicatie 36. Dit benadrukt het belang en de invloed van spleetovergangen intercellulaire communicatie in meercellige organismen. In tegenstelling tot spleetovergangen intercellulaire communicatie paracriene intercellulaire communicatie is niet afhankelijk van cel-cel bijstelling, omdat impliceert de diffundeerbare extracellulaire messengers (figuur 2). Verschillende soorten signaalmoleculen worden uitgebracht in de extracellulaire ruimte door signalering cellen. Het molecuul wordt dan naar de doelcel, waar het wordt gedetecteerd door een specifiek receptoreiwit. Vervolgens wordt het receptor-complex signaal induceert een cellulaire reactie diewordt beëindigd door verwijdering van het signaal, inactivering of desensibilisatie. Uitgebracht lipofiele extracellulaire signalen boodschappers penetreren het membraan en handelen op intracellulaire receptoren. Daarentegen hebben hydrofiele boodschappers niet over de plasmamembraan van de reagerende cel, maar fungeren als een ligand dat bindt aan het oppervlak tot expressie gebrachte receptor eiwitten, die doorzenden het signaal naar de intracellulaire omgeving. Drie belangrijke families van celoppervlak receptor-eiwitten aan dit proces: ionkanaal-gekoppelde, enzyme-linked, en G eiwit-gekoppelde. De vrijgegeven boodschappermolecule kan handelen receptoren van dezelfde cel (autocriene) op doelwitcellen in de nabijheid (paracriene) of op verre doelcellen die de bloedsomloop (endocriene) vereist.
In vele celtypen, waaronder corneale endotheel 28,29, ATP is een van de belangrijkste hydrofiele, paracriene factoren die de voortplanting van intracellulaire Ca2 +-golven 37-40 drijven. During mechanische vervorming, hypoxie, ontsteking of stimulatie door verschillende agenten, kan ATP uit gezonde cellen 41-44 worden uitgebracht in reactie op shear stress, rek, of osmotische zwelling 44,45. Verschillende ATP-afgifte mechanismen geopperd, zoals vesiculaire exocytose 44 en een veelheid van transportmechanismen, zoals ATP-bindende cassette (ABC) transporters, plasmalemmal spanningsafhankelijke anion kanalen 46, P2X7 receptor kanalen 47,48, alsmede connexin hemichannels 49-52 en pannexin hemikanalen 43,49,53. Extracellulair ATP kan snel gehydrolyseerd ADP, AMP en adenosine 54,55 door ectonucleotidases die in het extracellulaire milieu. Het extracellulair vrijgegeven ATP en zijn metaboliet ADP 56 zal verspreiden via diffusie. De daaropvolgende interactie van deze nucleotiden purinerge receptoren in de naburige cellen is betrokken bij de propagation van intercellulaire Ca2 +-golven 28,37,51. Twee verschillende klassen van purinerge receptoren aanwezig zijn: adenosine is de voornaamste natuurlijke ligand voor P1-purinoceptoren, terwijl zowel purine (ATP, ADP) en pyrimidine (UTP, UDP) nucleotiden handelen meeste P2-purinoreceptoren 57.
Intercellulaire communicatie kan worden onderzocht door verschillende methoden, zoals schrapen loading, kleurstofoverdracht, lokale uncaging van agonisten zoals IP3 en Ca 2 +, mechanische stimulatie enz.. Hier beschrijven we de studie van Ca 2 +-golven opgewekt door mechanische stimulatie van een enkele cel. Het voordeel van het bestuderen van Ca 2 +-golven door mechanische stimulatie is dat het een eenvoudig hulpmiddel om de verspreiding van de Ca 2 +-golf in de tijd te kwantificeren en geeft kwantitatief vergelijken van verschillende voorbehandelingen van de cellen. In het corneale endothelium, die intracellulaire Ca 2 +-golven kunnen een cogecoördineerd antwoord van de monolaag, wordt als een mogelijke afweermechanisme van de niet-regeneratieve corneale endotheel helpen het endotheel aan extracellulaire spanningen tijdens intraoculaire chirurgie weerstaan, of na blootstelling aan ontstekingsmediatoren bij afstoting of uveitis 58,59.
In dit manuscript beschrijven we een eenvoudige methode om intracellulaire Ca2 +-golven meten monolagen van primaire boviene corneale endotheelcellen door een lokale en gecontroleerde mechanische stimulatie met behulp van een micropipet. Mechanisch gestimuleerde cellen reageren met een lokale toename van intracellulaire IP3 en Ca2 +, die beide essentiële intracellulaire signalerende moleculen die rijden intracellulaire Ca 2 +-golven 11,67. IP3 wordt direct overgebr…
The authors have nothing to disclose.
Onderzoek uitgevoerd in het laboratorium werd ondersteund door subsidies van het Fonds voor Wetenschappelijk Onderzoek – Vlaanderen (FWO; subsidie nummers G.0545.08 en G.0298.11), de Interuniversitaire attractiepolen Program (Federaal Wetenschapsbeleid; toekenningsnummer P6/28 en P7/13) en is ingebed in een FWO-ondersteund onderzoeksgemeenschap. CDH is een post-doctoraal onderzoeker van het Fonds voor Wetenschappelijk Onderzoek – Vlaanderen (FWO). De auteurs zijn erg dankbaar voor alle huidige en voormalige leden van het Laboratorium voor Moleculaire en Cellulaire Signalering (KU Leuven), dr. SP Srinivas (Indiana University School of Optometrie, USA), het laboratorium van Dr Leybaert (Universiteit Gent) en van Dr Vinken (VUB) die behulpzaam discussies verstrekt, geoptimaliseerde procedures of betrokken waren bij de ontwikkeling van instrumenten voor de studie van connexine hemikanalen.
Name of Reagent/Material | Company | Catalog Number | Column1 |
Earle’s Balanced Salt Solution (EBSS) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14155-048 | |
Iodine | Sigma-Aldrich (Deisenhofen, Germany) | 38060-1EA | |
Dulbecco’s Modified Eagle’s Medium (DMEM) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 11960-044 | |
L-glutamine (Glutamax) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 35050-038 | |
Amphotericin-B | Sigma-Aldrich (Deisenhofen, Germany) | A2942 | |
Antibiotic-antimycotic mixture | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 15240-096 | |
Trypsin | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 25300-054 | |
Dulbecco’s PBS | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14190-091 | |
Fluo-4 AM | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | F14217 | |
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) | Sigma-Aldrich (Deisenhofen, Germany) | A265 | |
Apyrase VI | Sigma-Aldrich (Deisenhofen, Germany) | A6410 | |
Apyrase VII | Sigma-Aldrich (Deisenhofen, Germany) | A6535 | |
Gap26 (VCYDKSFPISHVR) | Custom peptide synthesis | ||
Gap27 (SRPTEKTIFII) | Custom peptide synthesis | ||
Control Peptide (SRGGEKNVFIV) | Custom peptide synthesis | ||
siRNA1 Cx43 (sense: 5’GAAGGAGGAGGAACU-CAAAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA2 Cx43 (sense: 5’CAAUUCUUCCUGCCGCAAUdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5’GGUAAACG-GAACGAGAAGAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
Two chambered glass slides | Laboratory-Tek Nunc (Roskilde, Denmark) | 155380 | |
Confocal microscope | Carl Zeiss Meditec (Jena, Germany) | LSM510 | |
Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner) | PI Polytech (Karlsruhe, Germany) | P-280 | |
HVPZT-amplifier | PI Polytech (Karlsruhe, Germany) | E463 HVPZT-amplifier | |
Glass tubes (glass replacement 3.5 nanoliter) | World Precision Instruments, Inc. Sarasota, Florida, USA | 4878 | |
Microelectrode puller | Zeitz Instrumente (Munchen, Germany) | WZ DMZ-Universal Puller |