Matrix-assisted laser desorption / jonisering Time of Flight (MALDI-TOF) Masspektrometrisk Analys av intakta proteiner större än 100 kDa

Chemistry
 

Summary

Exakt massa mätning är ett viktigt steg under utredningen av proteiner. Matris-assisterad laser desorption / jonisering (MALDI) masspektrometri (MS) kan användas för en sådan beslutsamhet och dess viktigaste fördel är tolerans mot salter, rengöringsmedel och föroreningar. Här visar vi en tillgänglig metod för analys av proteiner större än 100 kDa av MALDI-MS.

Cite this Article

Copy Citation | Download Citations

Signor, L., Boeri Erba, E. Matrix-assisted Laser Desorption/Ionization Time of Flight (MALDI-TOF) Mass Spectrometric Analysis of Intact Proteins Larger than 100 kDa. J. Vis. Exp. (79), e50635, doi:10.3791/50635 (2013).

Please note that all translations are automatically generated.

Click here for the english version. For other languages click here.

Abstract

Effektivt bestämma massor av proteiner är avgörande för många biologiska studier (t.ex. för strukturundersökningar biologi). Exakt massa bestämning tillåter en att bedöma riktigheten av protein primära sekvenserna, närvaron av mutationer och / eller post-translationella modifieringar, en eventuell proteinnedbrytning, provets homogenitet, och graden av isotop blandas i fallet med märkning (t.ex. 13 C-märkning ).

Elektrospray jonisation (ESI) masspektrometri (MS) används allmänt för bestämning av massan av den denaturerade proteiner, men dess effektivitet påverkas av sammansättningen av provbuffert. I synnerhet förekomsten av salter, detergenter, och föroreningar undergräver effektiviteten av proteinanalys med ESI-MS. Matrix-assisted laser desorption / jonisation (MALDI) MS är ett attraktivt alternativ, på grund av dess salt tolerans och enkelheten i datainsamling och tolkningtion. Dessutom är lättare med MALDI-MS på grund av frånvaron av överlappande höga laddningstillstånd distributioner som finns i ESI spektra massbestämning av stora heterogena proteiner (större än 100 kDa).

Här presenterar vi en tillgänglig metod för analys av proteiner större än 100 kDa med MALDI-tiden av flyg (TOF). Vi illustrerar fördelarna med att använda en blandning av två matriser (dvs 2,5-dihydroxibensoesyra och α-cyano-4-hydroxikanelsyra) och användbarheten av det tunna skiktet metod som metod för provavsättning. Vi diskuterar också den avgörande roll som matris och lösningsmedels renhet, av de standarder som används för kalibrering av laserenergi, och om förvärvstiden. Sammantaget ger vi information som är nödvändig för en nybörjare för att analysera intakta proteiner större än 100 kDa av MALDI-MS.

Introduction

Strukturbiologi bygger på produktion av högkvalitativa proteiner 1 och måste därför kombineras med effektiva och tillförlitliga metoder för proteinanalys 2,3. I vår masspektrometri (MS) laboratorium inom ett institut för strukturbiologi måste vi bekräfta primära sekvens av proteiner, utvärdera förekomsten av mutationer och posttranslationella modifieringar, nedbrytning av proteiner, provets homogenitet, och kvaliteten på isotopmärkning (t.ex. deuterad proteiner för kärnmagnetisk resonans studier 4). Eftersom strukturella biologer använder begränsad proteolys att skilja strukturellt stela domäner från flexibla delar, måste vi på ett tillförlitligt sätt karakterisera sådana trunkerade proteiner med hjälp av MS.

När biomolekyler analyseras av MS, är två möjliga metoder används för att mjukt jonisera sådana tunga och instabila molekyler. Elektrospray jonisation (ESI) joniserar molekyler direkt frånflytande fas 5, matris-assisterad laser desorption jonisering (MALDI) kräver att biomolekyler är co-kristalliserade med ultraviolett absorberande organiska molekyler (dvs matris molekyler) 6.

ESI time-of-flight (TOF) MS kopplas till vätskekromatografi har blivit en rutinteknik för analys av intakta proteiner, eftersom det tillåter bestämning av massan med hög noggrannhet (≤ 50 ppm). Det är emellertid ganska känsliga för sammansättningen av provbuffert (i synnerhet salter och detergenter) och föroreningar (t.ex. polymerer) som ibland är svåra att eliminera, orsakar dämpning av analytsignalen.

MALDI-TOF MS representerar ett effektivt alternativ till ESI-MS, eftersom dess prestanda påverkas mindre av buffertkomponenter, detergenter och föroreningar, och medger intakt protein massbestämning med tillräcklig noggrannhet (≤ 500 ppm) för sekvens validering. Efter protein matsmältning, MALDI-TOF-MS kan också användas för att analysera de erhållna peptider för ytterligare bekräftelse primära sekvensen av den så kallade "peptidmassa-fingeravtryckstagning".

I våra händer, massbestämning av intakta proteiner, som är större än 100 kDa och heterogena (på grund av ändringar eller trunkeringar), är lättare med MALDI-MS än med ESI-MS. Detta är på grund av bristen på överlappande laddnings statliga distributioner som finns i ESI-spektra. Eftersom MALDI process är inte beroende av analytstorlek 7, sådana metod ger hög känslighet när en biomolekyl massa är över 100 kDa. Anmärkningsvärda analyser av intakta proteiner utfördes med hjälp av hemmagjorda instrument mellan slutet av 1980-talet och början av 1990-talet 8-11.

MALDI-TOF kan också användas som verktyg för screening för att utvärdera kvaliteten av proteinprov, eftersom det kräver mindre tid för provberedning och är mindre känslig för interferences pga vanliga föroreningar (t.ex. salter). Efter en första, snabb utvärdering genom MALDI-MS, kan ett prov som skall analyseras ytterligare genom ESI-TOF för att bestämma dess massa med högre noggrannhet. Dessutom MALDI genererar joner som innehåller färre avgifter än ESI och därmed förvärva och tolka MALDI data enklare. Detta gör att studenter som arbetar i strukturbiologi för att analysera deras rekombinanta proteiner strax efter en kort träning.

Två viktiga faktorer påverkar kvaliteten på MALDI spektra: matrisen och den teknik som används för matrisen deponering (t.ex. torkad droppe 8 och tunt lager 12-16,17,18). En enda organisk matris [t.ex. sinapinsyra (SA) från 19 till 21 eller α-cyano-4-hydroxikanelsyra (α-CHCA) 14,22,23] används ofta för MS undersökning av intakta proteiner och tvärbundna proteinkomplex . Med hjälp av α-CHCA, Chait grupp tidigare presenterade ett detaljerat protokoll för prepa en ultra tunt lager före MALDI analys av lösliga och membranproteiner 14,15. Nyligen Gorka et al. Illustreras grafitbaserat mål beläggning för att förbättra MALDI analys av peptider och proteiner med användning av α-CHCA som matris 24.

Här presenterar vi ett enkelt protokoll för analys av intakta proteiner med MALDI-TOF MS, att använda en blandning av två matriser: 2,5-dihydroxibensoesyra (DHB) och α-CHCA 25. Vi utvärderade systematiskt utförandet av DHB-CHCA blandning jämfört med SA-och α-CHCA matriser för kontroll av intakta proteiner. Matrisen Blandningen gör en bättre upplösning (dvs. proteintoppar är mycket skarpare). Dessutom, närvaron av intensiva multipla laddningar joner (dvs. M 2 H 2 *, M 3 H 3 +, etc.) gör det möjligt för en mer noggrann bestämning av massan på grund av upplösning av axiella MALDI-TOF-instrument som är högre vid lägre massa över laddning (m / z) 26. Detta är särskilt användbart för molekylviktsbestämning av proteiner som är större än 100 kDa.

Högre känslighet är också nås med hjälp av DHB-CHCA blandning (0,5 pmol protein prickiga på MALDI målet).

Såsom vi nämnde ovan, är en viktig faktor som bör beaktas vid användning av MALDI instrument matrisavsättning. Laugesen et al. Föreslagna användningen av DHB-CHCA blandning för första gången 25, med användning av den torkade droppavsättnings. Emellertid observerade vi bättre resultat (exempelvis mycket högre känslighet) när vi utnyttjat det tunna lagret metod där det första skiktet är bildat av den α-CHCA löst i aceton. Det tunna skiktet metod 12,27 antyder bildningen av ett homogent substrat av matriskristaller på MALDI-målet, som beskrevs i ett Jove video tidigare 15. Då provet avsätts på detta substrat, och slutligenytterligare matris deponeras (se nedan). I den här artikeln, vi visar också hur man kan sätta in provet på MALDI målet, men också hur man rengör målet 15, att omkristallisera och bereda matriserna.

Avslutningsvis vi strävar efter att ge all den information som behövs för att analysera intakta proteiner till forskare (i synnerhet strukturbiologer) som behöver utvärdera kvaliteten på producerade proteiner på ett snabbt och enkelt sätt, och som inte är så bekant med MALDI-TOF MS. Som förutspått i mitten av 1990-talet 28, har MS hade en ökad effekt på biologisk forskning, som dess tillgänglighet till biologer har ökat. Vi hoppas att den information vi förutsatt kommer att vara användbart för att göra MALDI-TOF tillgänglig för biologer och forskare som vill börja använda masspektrometri.

Protocol

1. Proteinprovberedning: Buffer Exchange (tillval)

5-25 | il av mikromolära koncentrationer av protein (1-20 | iM) är nödvändiga. Buffert utbyte kan ske med hjälp av centrifugal ultrafiltreringsanordningar (t.ex. Vivaspin, Sartorius) eller mikro gelfiltreringskolonner (t.ex. Micro Bio-Spin 6 kromatografikolonner, Bio-Rad) 29,30. Buffert utbytessteg kan upprepas 2-3x. Detaljerad beskrivning av buffertutbyte tidigare presenterade 29,30. Till exempel använder vi 20 mM Tris (hydroximetyl) aminometan (dvs. Tris) pH 8 som slutlig buffert.

OBS: Detta steg kan utelämnas i många fall. Det bör utföras när ett proteinprov innehåller molekyler eller buffertar som kraftigt kan störa MS-detektion [t.ex. glycerol, 4 - (2-hydroxietyl)-1-piperazinetansulfonsyra, HEPES]. Det är också användbart för att förbättra qutionalitet av spektra.

2. Omkristallisation av matriser för att förbättra deras renhet (tillval)

  1. Häll 10 ml av 40% etanol (EtOH) i en Pyrex-kolv.
  2. Lägg till 600 mg av en matris.
  3. Med hjälp av ett vattenbad och en motståndsvärmare värmer man matrislösning och rör om tills matrisen är helt upplöst med användning av en glasstav eller en magnetisk omrörare.
  4. Upprepa steg 2 tills du har en mättad lösning.

Notera: Genom att använda en för stor volym lösningsmedel eller upplösning av matrisen långt under kokpunkten hos lösningen kommer att orsaka ett dåligt utbyte av kristaller eller inga kristaller alls.

  1. Låt lösningen svalna långsamt. Du kan lämna den vid rumstemperatur under flera timmar och därefter vid 4 ° C över natten. Observera: om kristaller inte bildas, kan kristallisation framkallas genom att skrapa insidan av bägaren (strax under lösningens yta) med användning av en glasomrörningsstav.
  2. Samla de matris kristaller genom filtrering.
  3. Skölj kristallerna med ett minimum av iskall lösningsmedel och filtrera dem.
  4. Tillåt kristallerna torka. Du kan använda vakuum för detta steg.

3. Rengöring av MALDI Stainless Steel Target

  1. Skölj MALDI plattan med metanol (MeOH) och torka försiktigt med en rengörings vävnad speciellt framtagen för laboratorieapplikationer (t.ex. Kimwipe).
  2. Skölj målet med H2O och torka av den med en rengöringsduk.
  3. Sätt i MALDI plattan i en 600 ml bägare och täck den med 50% EtOH.
  4. Sonikera målet i EtOH-lösning under 10 minuter i ett ultraljudsbad.
  5. Om det finns rester kvar på plattan, upprepa stegen 1-4 igen.
  6. Slutligen, skölj målet med MeOH (eller med vatten, se not nedan), luta den på ett sätt som all vätska samlas på en rengöringsduk. Låt målet torrt vid rumstemperatur eller med användning av en kväve-gasflödet.

Notera: Ett liknande förfarande har tidigare beskrivits 15.

Obs: lösningsmedel (MeOH eller vatten) som används för den sista sköljningen av målet avgör vissa mål-funktioner. Om målet sköljs med MeOH, sprider provet på målet mycket mer än när man använder vatten.

4. α-CHCA Thin Layer Lösning: Förberedelse och deposition på MALDI Target

  1. Lös α-CHCA i aceton, för att göra en mättad lösning.
  2. För hand (utan någon pipett) doppa en 10 | il spets (t.ex. GELoader Tip, Eppendorf) i α-CHCA mättad lösning: en liten mängd av lösningen kommer att flyta i spetsen (på grund av kapillaritet).
  3. Tryck mycket snabbt (dvs. 1 sek) MALDI målet med pipettspetsen och deponera α-CHCA acetonlösning på MALDI målet. Detta kommer att utgöra matrisen tunt skikt, där proteinetProvet kommer att deponeras. Försök att skapa ett tunt skikt fläck så liten som möjligt.

OBS: När du använder SA som matris, förbereder vi ett tunt lager med hjälp av en mättad lösning av SA i aceton.

5. Beredning av Natrix Solutions: SA, α-CHCA, DHB och CHCA_DHB Blandning 25

  1. Bered en 20 mg / ml SA lösning i ACN, 0,1% TFA (70:30, vol / vol).
  2. Förbered 20 mg / ml α-CHCA lösning i ACN och 5% myrsyra (70:30, vol / vol) [namnges som "α-CHCA lösning"].
  3. Förbered en 20 mg / ml DHB lösning i ACN och 0,1% trifluorättiksyra (TFA) (70:30, vol / vol) [namnges som "DHB lösning"].
  4. Blanda "α-CHCA lösning" och "DHB-lösning" i förhållandet 1:1 (volym / volym), för att få "CHCA_DHB lösningen".

Anm: Man kan blanda "α-CHCA lösning" och "DHB lösning" i olika förhållanden, när man analyserar proteiner med massa mindre än 100 kDa. För EXAmple ett förhållande av 40:60 mellan α-CHCA och DHB (vol / vol) ger en bättre upplösning, men mindre känslighet (se diskussion).

6. Prov Deposition på MALDI Target

  1. Deposition 0,5 pl av provproteinet på tidigare beredda α-CHCA tunt lager. Omedelbart efter detta, tillsätt 0,5 | il av matrislösning (dvs. SA lösningen eller α-CHCA lösning eller "CHCA_DHB mix"). Detta innebär blandning av provet och matrisen på målet.

Obs: Vanligtvis ett blandar proteinprovet med matrisen i ett förhållande 1:1. Detta förhållande är avgörande för den goda kvaliteten på MALDI spektra. Om du vill testa olika provkoncentrationer, kan du använda ACN_formic syralösning (beskriven ovan) för att späda provet.

Obs: Om du vill kan du blanda provet och matrisen i ett rör och sedan sätta in den blandade "sample_matrix lösningarning "på det tunna skiktet.

OBS: Vi föreslår att du testar olika provkoncentrationer eftersom späda provet kan du minska störningar av föroreningar. För att späda ut provet, kan man använda ACN_formic syralösning (beskriven ovan) för att späda ut provet.

7. Calibrant Avlagring

  1. Deposition 0.5 l av kalibreringsstandard (t.ex. "protein standard II", Bruker Daltonics, Bremen) tillsätt sedan 0,5 l av matrislösningen.

OBS: Fyll på kalibrerings på MALDI tallrik bredvid proteinprovfläckar (se diskussion).

8. MALDI Spectra Förvärv av Calibrant och proteinprover

När proverna och kalibrerings torkas, kan du följa de "spots" i mikroskop. Denna iakttagelse är frivilligt och kan vara intressant främst för nybörjare. För att få provspektra, sätt in the mål i MALDI-TOF-instrument och välja lämpliga instrumentella parametrar som är olika för varje typ av utrustning. För att få den mest lämpliga upplägg bör man följa tillverkarens rekommendationer. Som allmänna överväganden vid analys av intakta proteiner, bör man använda instrumentet i linjärt läge (ej i reflektor-läge, vilket är lämpligt för peptider analyser). Normalt vi utnyttja vårt instrument i positiv-jon-läge. Dessutom är en viktig parameter för "pulsade jon utvinning" som förbättrar den instrumentella upplösningen 31. I enkla termer kan den "pulsad ion extraction" definieras som en paus mellan genereringen av provjoner och den tidpunkt då de joner accelereras mot detektorn. Vid analys av intakta proteiner, bör man utnyttjade en "pulsad jon utvinning" (t ex 500 ns) större än när man observerar peptider (t ex 80 ns).

Välj lämplig m / z område, förvärva spektra of kalibrerings och kalibrera instrumentet. När du förvärva spektra av dina prover, använda lämplig laserintensiteten (se diskussion).

Representative Results

Vi har analyserat ett intakt protein (kromosomregion underhåll ett protein, CRM1; molekylvikt: 123.386 Da) med hjälp av två olika matriser, två deponeringsmetoder och samma laserintensiteten (figur 1). SA och en CHCA_DHB blandning utnyttjades som matriser. Blandningen gav masspektra av högre kvalitet i termer av signal-brusförhållande och av känslighet (fig. 1A och B). Framför allt kunde vi upptäcka 0.5 pmol protein deponeras på MALDI målet (Figur 1C). Samma mängd protein var knappt detekterbar med hjälp av SA (figur 1D). Dessutom, med hjälp av matriser blandningen, den föredragna metoden för matrisen avsättning var "tunnskikts"-metoden (Figur 1A). Med hjälp av "torkat droppe" metod, vi inte upptäcka något protein med en massa större än 100 kDa (data visas ej). Använda CHCA_DHB blandningen (figurerna 1A och 1C), multiplicera laddad jon av protein observerades, vilket tillåter bestämning av massan med högre noggrannhet, eftersom den maximala upplösningen i axiella MALDI-TOF-instrument som är omvänt proportionell mot m / z 26.

Vi analyserade även mono beta-galaktosidas (116.300 Da) (Figur 2). De CHCA_DHB spektra var bättre än SA spektra vad gäller känslighet och upplösning. Vidare, närvaron av multipelt laddade joner (M 2 +, M 3 + och M-4 +) tillät oss att bekräfta massan av proteinet med högre noggrannhet (figurerna 2A och 2C). Med användning av tunnskikts tillvägagångssätt jämförde vi prestanda CHCA_DHB blandningen, SA och α-CHCA enbart för analys av ett immunglobulin IgG (148.500 Da) (Figur 3). När vi korrelera olika uppgifter, var proteinsignaler högre och med bättre upplösning i CHCA_DHB spektra. Avslutningsvis användningen av CHCA_DHB blandningen och det tunna skiktet deponeringsmetod signifikant förbättring i kvaliteten på stora intakt protein masspektra förvärvats med hjälp av en MALDI TOF instrument.

Figur 1
Figur 1. MALDI-TOF-analys av intakt kromosom region underhåll 1 protein (CRM1), molekylvikt: 123.386 Da. A) 1 pmol CRM1 analyserades med hjälp av DHB_CHCA mix som matris B) belopp:. 1 pmole, matrix:. SA C) belopp: 0,5 pmol; matrix:. DHB_CHCA D) belopp: 0,5 pmol; matrix: SA. Signalen på topparna, uttryckta i en godtycklig intensitetsenhetsskala, normaliseras till det maximala nuvärde i varje spektrum.

pg "src =" / files/ftp_upload/50635/50635fig2.jpg "/>
Figur 2. MALDI-TOF-analys av intakt beta-galaktosidas (116.300 Da). A) belopp: 20 pmol; matrix DHB_CHCA B) belopp:. 20 pmol, matrix:. SA C) belopp: 5 pmol, matrix:. DHB_CHCA D) belopp: 5 pmol; matris: SA.

Figur 3
Figur 3. MALDI-TOF-analys av ett intakt immunglobulin, IgG (148.500 Da), belopp:. 1.7 pmol Spektra erhålls med CHCA_DHB blandningen var mycket mer intensiv (max: 8200 godtycklig enhet, au) än SA spektra (max: 1.200 au) och α-CHCA spektra (max: 4500 au)

Discussion

Vi presenterade en detalj protokoll att förvärva hög kvalitet masspektra av stora intakta proteiner med molekylvikter större än 100 kDa, med användning av en MALDI-TOF-instrument. Ett antal kritiska aspekter av provberedning bör övervägas noga för att förbättra kvaliteten på massan spektra. Matriser och lösningsmedel av hög renhet är av kritisk betydelse eftersom alla föroreningar som finns i matriserna och lösningsmedlen är koncentrerade till det MALDI målet efter lösningsmedelsavdunstning. För att öka renheten hos de MALDI-matriser är det möjligt att rena dem med användning av klassiska omkristallisation metoder (se ovan). Vi rekommenderar också att nyligen förbereda matriser lösningar (åtminstone en gång i veckan) för att förbättra matrisen kristallisation och för att undvika matrisnedbrytning.

Matrisen deponerings tillvägagångssätt är mycket viktigt för den slutliga kvaliteten hos spektra. Såsom beskrivits ovan, är det tunna lagret metod vår metod of val 12. Dessutom optimeras vi den metod för avsättning av det första skiktet. När matrisen upplöses i aceton för erhållande av en mättad lösning, tillåter propanon snabb avdunstning av lösningsmedlet, utan också gör storleken på det första skiktet mycket svårt att kontrollera. Vi föreslår att du använder en GELoader spets så liten pensel som du doppar i matrix_acetone lösningen för att få en minimivolym som du snabbt sätta in på målet. Storleken på det första skiktet styr på något sätt den slutliga storleken på MALDI platsen: en liten fläck (dvs. från 0,5 till 0,75 mm i diameter) är att föredra på grund av att provkoncentrationen i detta fall är högre än i fallet med en stor plats. Att få en liten plats skiljer sig från den ultratunna lager strategi som tidigare föreslagits i en JOVE video 15. I Fenyo et al. Är det tunna lagret lösningen spreds över MALDI målet med sidan av en pipett spets. Denna metod kräver att testa det tunna skikt som bör uppfylla särskilda kriterier(T.ex. hastighet av lösningsmedel avdunstning). Om kriteriet inte uppfylls, bör MALDI målet tvättas och ett nytt tunt lager bör utarbetas. Detta gör förberedelserna ganska mödosamt för en nybörjare. Vidare avsättningen av prov / matris blandningen på plattan kräver aspiration av överskott av lösningsmedel med hjälp av en vakuumledning och ett tvättsteg med användning av TFA 15 är nödvändigt, vilket gör Fenyo et al. Beredningen lite svårare än vårt tillvägagångssätt.

Volymförhållandet mellan matrisen och provet är mycket viktigt för en framgångsrik analys av intakta proteiner genom MALDI-TOF. Efter att ha testat olika förhållanden föreslår vi att använda ett 01:01 förhållande. En annan matris: urvalsandel kan äventyra kvaliteten på spektra, förmodligen på grund av inhomogen kristallisering. Den ordning i vilken matris och prov deponeras är också kritisk. Efter avsättning matrisen tunnskikts provet deponeras och omedelbart efter (före sample plats blir torr) den CHCA_DHB blandningen tillsätts. Detta förfarande har definierats som "sandwichmetoden" 27, där provet ensamt avsätts mellan två matrisskikt. Som ett alternativ kan den CHCA_DHB lösning och provet blandas i 0,5 ml rör och därefter fläckvis på CHCA tunt skikt 12. Detta ger en fläck med ett homogent skikt av kristaller resulterar i hög kvalitet spektra. Vid analys av proteiner med en massa som är mindre än 100 kDa, koncentrationen av DHB kan ökas (t.ex. 60:40 DHB: CHCA), vilket kan ge skarpare topp, men skulle kunna äventyra mätkänslighet (dvs. mindre intensiva toppar).

För en riktig instrumentkalibrering, är det viktigt att sätta in kalibreringsstandarder mycket nära prov fläckar, tillåter en att få en bättre massnoggrannhet. En "pseudo-intern kalibrering" har tidigare föreslagit 15: efter förvärvet av en provspektrum, kalibrerings plats is laserskott och-signal i den kalibreringsvätska tillsätts till provspektrum. Detta gör att du till internt kalibrera provspektrum med hjälp av kalibrerings toppar.

Laser energi bör också noga kontrolleras under spektra förvärvet. I de flesta fall ökar högre energi känsligheten, men sänker upplösning. Vi föreslår att du använder den lägsta möjliga laserenergi utan att känsligheten för förvärvet. Dessutom, för att förbättra spektral kvalitet, kan man få fler skott på varje provpunkt. Normalt ju fler skott du förvärva (1,000-2,000 skott), desto högre intensitet av signalen. När slår fläcken med laser, ett behov att hitta rätt position (dvs. "sweet spot"), eftersom provet inte är homogent fördelad. Du kan skjuta på samma område tills signalen ökar, och sedan försöka hitta ett annat område som innehåller provet.

Sammanfattningsvis hög renhet av matriser och solvföräldrar, de metoder som används för prov och matriser avsättning på målet, läget för de standarder som används för kalibrering, intensiteten av laserenergi, förvärvstidpunkten (antal skott / spot) är kritiska faktorer som man bör ta hänsyn till när analys av intakta proteiner med MALDI-TOF MS.

Författare Bidrag

LS och EBE utformade experiment, utfört de masspektrometri experiment, analyserade data, och skrev manus.

Disclosures

Inga intressekonflikter deklareras.

Acknowledgements

Vi tackar Dr Christophe Masselon (iRTV, CEA, Grenoble) och medlemmar av virusinfektion och Cancer Group vid IBS, för sin kritiska utvärdering av manuskriptet och nyttiga diskussioner. Vi är tacksamma för Cyril Dian för slags gåva av proteinet CRM1. Detta vetenskapliga arbete ägde rum i masspektrometri anläggningen i Grenoble Instruera Centre (ISBG, UMS 3518 CNRS-CEA-UJF-EMBL). Det stöds ekonomiskt av den franska infrastruktur för integrerad Structural Biology Initiative (FRISBI, ANR-10-InSb-05-02), GRAL (ANR-10-LabX-49-01) [i Grenoble partnerskapet för strukturbiologi] och genom det franska nationella centret för vetenskaplig forskning (CNRS).

Materials

Name Company Catalog Number Comments
REAGENTS
Trizma hydrochloride Sigma T3253
Trizima Sigma T6066
Micro Bio-Spin 6 chromatography columns Bio-Rad 732-6221
Vivaspin 500 Sartorius VS0122 various molecular weight cut off
Methanol Fluka 14262
Ethanol Fluka 02860
KIMTECH SCIENCE Precision Wipes Tissue Wipers Kimberly Clark 05511
α-cyano-4-hydroxycinnamic acid Sigma Aldrich C8982
Acetone Sigma Aldrich 650501
2,5-dihydroxybenzoic acid Fluka 39319
GELoader Tips Eppendorf 0030 001.222
Acetonitrile Sigma Aldrich 34998
Formic acid Fluka 09676
Trifluoroacetic acid Sigma Aldrich 302031
Protein Standard II Bruker Daltonics 207234 It contains Trypsinogen, Protein A, Serum Albumin-Bovine
Immunoglobulin G ABSciex GEN602151
Name Company Catalog Number Comments
EQUIPMENT
Water purifier PURELAB Ultra Analytic ELGA LabWater 89204-052
Autoflex MALDI-TOF instrument Bruker Daltonics
MALDI-TOF target Bruker Daltonics

DOWNLOAD MATERIALS LIST

References

  1. Rupp, B. Biomolecular Crystallography : Principles, Practice, and Application to Structural Biology. Garland Science - Taylor & Francis Group. (2010).
  2. Cohen, S. L., Chait, B. T. Mass spectrometry as a tool for protein crystallography. Annual review of biophysics and biomolecular structure. 30, 67-85 (2001).
  3. Chait, B. T. Mass spectrometry--a useful tool for the protein X-ray crystallographer and NMR spectroscopist. Structure. 2, 465-467 (1994).
  4. Gans, P., et al. Stereospecific isotopic labeling of methyl groups for NMR spectroscopic studies of high-molecular-weight proteins. Angew Chem Int Ed Engl. 49, 1958-1962 (2010).
  5. Wilm, M. Principles of electrospray ionization. Molecular & cellular proteomics : MCP. 10, M111 009407 (2011).
  6. Urban, P. L., Amantonico, A., Zenobi, R. Lab-on-a-plate: extending the functionality of MALDI-MS and LDI-MS targets. Mass spectrometry reviews. 30, 435-478 (2011).
  7. De Hoffmann, E., Stroobant, V. Mass Spectrometry: Principles and Applications. Wiley. (2007).
  8. Karas, M., Hillenkamp, F. Laser desorption ionization of proteins with molecular masses exceeding 10,000 daltons. Analytical chemistry. 60, 2299-2301 (1988).
  9. Spengler, B., Cotter, R. J. Ultraviolet laser desorption/ionization mass spectrometry of proteins above 100,000 daltons by pulsed ion extraction time-of-flight analysis. Analytical chemistry. 62, 793-796 (1990).
  10. Beavis, R. C., Chait, B. T. High-accuracy molecular mass determination of proteins using matrix-assisted laser desorption mass spectrometry. Analytical chemistry. 62, 1836-1840 (1990).
  11. Hillenkamp, F., Karas, M., Beavis, R. C., Chait, B. T. Matrix-assisted laser desorption/ionization mass spectrometry of biopolymers. Analytical chemistry. 63, 1193A-1203A (1991).
  12. Beavis, R. C., Chait, B. T. Matrix-assisted laser desorption ionization mass-spectrometry of proteins. Methods in enzymology. 270, 519-551 (1996).
  13. Xiang, F., Beavis, R. C. A method to increase contaminant tolerance in protein matrix-assisted laser desorption/ionization by the fabrication of thin protein-doped polycrystalline films. Rapid Communications in Mass Spectrometry. 8, 199-204 (1994).
  14. Cadene, M., Chait, B. T. A robust, detergent-friendly method for mass spectrometric analysis of integral membrane proteins. Analytical chemistry. 72, 5655-5658 (2000).
  15. Fenyo, D., et al. MALDI sample preparation: the ultra thin layer method. J. Vis. Exp.. (3), e192 (2007).
  16. Gabant, G., Cadene, M. Mass spectrometry of full-length integral membrane proteins to define functionally relevant structural features. Methods. 46, 54-61 (2008).
  17. Hook, P., et al. Long range allosteric control of cytoplasmic dynein ATPase activity by the stalk and C-terminal domains. The Journal of biological chemistry. 280, 33045-33054 (2005).
  18. Vorm, O., Roepstorff, P. Peptide sequence information derived by partial acid hydrolysis and matrix-assisted laser desorption/ionization mass spectrometry. Biological mass spectrometry. 23, 734-740 (1994).
  19. Beavis, R. C., Chait, B. T. Cinnamic acid derivatives as matrices for ultraviolet laser desorption mass spectrometry of proteins. Rapid Communications in Mass Spectrometry. 3, 432-435 (1989).
  20. Madler, S., Boeri Erba,, E,, Zenobi, R. MALDI-ToF Mass Spectrometry for Studying Noncovalent Complexes of Biomolecules. Topics in current chemistry. (2012).
  21. Wortmann, A., Pimenova, T., Alves, S., Zenobi, R. Investigation of the first shot phenomenon in MALDI mass spectrometry of protein complexes. The Analyst. 132, 199-207 (2007).
  22. Beavis, R. C., Chaudhary, T., Chait, B. T. Alpha-Cyano-4-hydroxycinnamic Acid as a Matrix for Matrix-assisted Laser Desorption Mass Spectrometry. Organic Mass Spectrometry. 27, 156-158 (1992).
  23. Liu, Z., Schey, K. L. Optimization of a MALDI TOF-TOF mass spectrometer for intact protein analysis. Journal of the American Society for Mass Spectrometry. 16, 482-490 (2005).
  24. Gorka, J., Bahr, U., Karas, M. Graphite supported preparation (GSP) of alpha-cyano-4-hydroxycinnamic acid (CHCA) for matrix-assisted laser desorption/ionization mass spectrometry (MALDI-MS) for peptides and proteins. Journal of the American Society for Mass Spectrometry. 23, 1949-1954 (2012).
  25. Laugesen, S., Roepstorff, P. Combination of two matrices results in improved performance of MALDI MS for peptide mass mapping and protein analysis. Journal of the American Society for Mass Spectrometry. 14, 992-1002 (2003).
  26. Sparkman, D. O. Mass Spectrometry Desk Reference. Global View Publishing. (2000).
  27. Kussmann, M., Roepstorff, P. Sample preparation techniques for peptides and proteins analyzed by MALDI-MS. Methods Mol Biol. 146, 405-424 (2000).
  28. Wang, R., Chait, B. T. High-accuracy mass measurement as a tool for studying proteins. Current opinion in biotechnology. 5, 77-84 (1994).
  29. Kirshenbaum, N., Michaelevski, I., Sharon, M. Analyzing large protein complexes by structural mass spectrometry. J. Vis. Exp. (40), e1954 (2010).
  30. Hernandez, H., Robinson, C. V. Determining the stoichiometry and interactions of macromolecular assemblies from mass spectrometry. Nature protocols. 2, 715-726 (2007).
  31. Vestal, M. L., Juhasz, P., Martin, S. A. Delayed extraction matrix-assisted laser desorption time-of-flight massspectrometry. Rapid Communications in Mass Spectrometry. 9, 1044-1050 (1995).

Comments

0 Comments


    Post a Question / Comment / Request

    You must be signed in to post a comment. Please or create an account.

    Usage Statistics