Mühendislik kanonik olmayan Amino asitler ve seçici basınç eklenmesi tarafından 'Altın' floresan ve kütle spektrometresi ve floresan göre Protein analizi

Bioengineering
 

Summary

Sentetik Biyoloji Mühendisliği proteinlerin kanonik olmayan amino asitlerin co-translational ekleme kullanarak benzersiz özellikleri ile sağlar. Burada, GFP türü fluorophore "altın" floresan protein (GdFP) olarak adlandırdığı roman Floresans spektroskopik özellikleri ile hayalice kırmızı kaymıştır bir türevi E. coli seçici basınç birleşme (SPI) yolu ile nasıl üretilir sundu.

Cite this Article

Copy Citation | Download Citations | Reprints and Permissions

Baumann, T., Schmitt, F. J., Pelzer, A., Spiering, V. J., Freiherr von Sass, G. J., Friedrich, T., Budisa, N. Engineering 'Golden' Fluorescence by Selective Pressure Incorporation of Non-canonical Amino Acids and Protein Analysis by Mass Spectrometry and Fluorescence. J. Vis. Exp. (134), e57017, doi:10.3791/57017 (2018).

Please note that all translations are automatically generated.

Click here for the english version. For other languages click here.

Abstract

Floresan proteinler temel yaşam bilimleri için özellikle canlı hücreler floresan mikroskopi için araçlardır. Aequorea victoria (avGFP) yeşil flüoresan protein hem de homologs diğer türlerden vahşi tipi ve mühendislik türevleri zaten optik spektrumu büyük bölümünün üzerini, spektral bir boşluk için yakın kızılötesi bölgede kalır hangi avGFP tabanlı fluorophores kullanılabilir değil. Floresan protein (FP) kırmızı kaymıştır türevleri önemli ölçüde spektral birden çok moleküler türlerin unmixing için toolkit genişletmek ama doğal olarak meydana gelen kırmızı değiştirdi FPs mercan türetilmiş veya deniz anemon var alt Floresans kuantum verimi ve düşük kaliteli fotoğraf istikrar avGFP türevleri ile karşılaştırıldığında. Daha fazla işleme ve olası chromophore'nın konjuge sistem far-red spektral bölge doğru genişlemesi de 20 kurallı amino asitler genetik kod tarafından reçete repertuar tarafından sınırlı. Bu sınırlamalarını aşmak için sentetik Biyoloji daha fazla spektral kırmızı sürekli değişen chromophore Triad'ın içine kanonik olmayan amino asitlerin ekleme yoluyla elde edebilirsiniz. SPI uygulamaya mühendis avGFP türevleri ile roman spektral özellikleri açıklanmaktadır. Protein ifade triptofan auxotrophic E. coli gerçekleştirilen zorlanma ve büyüme medya uygun indol öncüleri ile ilave tarafından. Hücrelerin içinde bu hareketlenme öncesi ilk belirtiler karşılık gelen triptofan analogları dönüştürülür ve yanıt UGG kodon olarak ribozomal makine tarafından proteinlerin dahil. Trp-66 yerine avGFP (ECFP) bir elektron 4-aminotryptophan tarafından geliştirilmiş "mavi" varyant olarak sonuçları şekil bir 108 nm Stokes kayması ve en fazla bir kuvvetle kırmızı kaymıştır emisyon GdFP (574 nm), thermodynamically daha daha istikrarlı olurken önceki ECFP. Kanonik olmayan amino asit kalıntı özgü birleşme kütle spektrometresi ile analiz edilir. GdFP spektroskopik özellikleri Yaşam Bilimleri içinde genetik olarak kodlanmış FPs değerli uygulamalardan biri olarak zaman çözüldü Floresans spektroskopisi ile karakterizedir.

Introduction

Denizanası Aequorea victoria 19621 (avGFP) yeşil flüoresan protein ve diğer ökaryotik hücrelerde 19942 kapaklı ilk ifadede keşfinden beri GFP ailesinin floresan proteinler haline gelmiştir son derece değerli araçlar ve yaşam bilimleri alanında hedefleri. Geniş genetik ve moleküler mühendislik dahil species-specific kodon kullanım düzeltilmesi, katlama, geliştirilmiş olgunlaşma, yüksek parlaklık, Oligomerizasyonda önlenmesi ve spektral ve fotokimyasal özelliklerini terzilik ivme geri dönülebilir olarak photoswitch3,4,5,6yeteneği de dahil olmak üzere. GFP borçlu, Floresans--dan onun 4-(p- hydroxybenzylidene) imidazolidin-5-1 (HBDI) chromophore. İkinci autocatalytically gelen amino asitlerin (Ser-65/Tyr-66/Gly-67'avGFP) sözde chromophore üçlü peptid omurga moleküler oksijen7etkisi altında içinde ek bir kovalent bağ oluşumu sonra oluşur. Resonantly stabilize konjuge sistem dinamik olarak görünen aralığın ve bu proteinlerin karakteristik yeşil Floresans emilimi sağlayan moleküler çevresi ile etkileşim kurar.

Chromophore üçlü içinde bir aromatik amino asit varlığı zorunludur. Ancak, standart amino asit repertuar sadece dört aromatik artıkları (onun, Phe, Trp ve Tyr) oluşmaktadır. Bu DsRed8 Discosoma striata coralimorphs veya mKate/mNeptune9 gibi en kırmızı kaymıştır doğal FPs göre önemli ölçüde daha fazla kırmızı kaymıştır avGFP türevleri elde etmek için geleneksel mutagenesis yaklaşımlar sınırlar Deniz anemone Entacmaea quadricolor. Bu nedenle, far-red ve yakın kızılötesi kısmını yukarıda 600 optik spektrumu nm seyrek GFP türevleri tarafından kaplıdır. Bu, tabii ki, spektral birkaç fluorophore tür aynı zamanda azaltma gerektirir Floresans mikroskobik yaklaşımlar için ciddi bir sınırlama. Örneğin, uzun dalga boyu işaretleyicileri Ayrıca yapmak için gerekli olan düşük emilim rejim karşıtlarının deri dokusu arasında 700-1000 nm derin doku10görüntüleme ayarları kullanın.

Floresan proteinler avGFP elde edilen spektroskopik özellikleri ve onların kromofor11kimyasal doğası dayalı çeşitli sınıflara ayrılır. İle onun triad Ser-65/Tyr-66/Gly-67, tarafsız, fenolik formu arasında dengelenmiş bir karışımı olarak vahşi tipli chromophore var (λmax 395 = nm, ε 21.000 M-1cm-1=) ve Anyonik phenolate formu (λmax 475 = nm, ε = 7,100 M -1cm-1) ve emisyon spektrum 508 tek bir zirve sergileyen nm. Bir H-bağ Glu-222 chromophore çevresinde için bağışladı Ser-65 hidroksil grubu kritik açısından önemlidir (mesafe: 3.7 Å), hangi bu karboksilat iyonlaşma teşvik etmektedir. Sınıf EGFP olduğu gibi bir Anyonik phenolate chromophore karakterizedir (Phe-64-Leu/Ser-65-Thr; λmax 488 = nm, ε = 35,600 M-1cm-1, λem 509 = nm). Ser-65-Thr(Ala,Gly) değiştirme nedeniyle tarafsız fenol form 395 nm uyarma zirvesine bastırılır ve Anyonik phenolate 470-475 nm pik gelişmiş ve 490 için kaymıştır beş - için six - kat nm. Sınıf II proteinler safir-GFP olduğu gibi tarafsız bir fenolik chromophore ile oluşur. Burada, Thr-203-Ile ikame bastırır neredeyse tamamen 399 yalnızca en yüksek bırakarak 475 nm uyarma nm. Anyonik chromophore düzgün solvated olamaz beri tarafsız haliyle tercih edilir. Sınıf III oluşur "sarı" floresan türevleri (EYFP; Ser-65-Gly/Val-68-Leu/ser-72-ala/thr-203-Tyr; λmax ε 514 = nm, ε 84, 600 M-1cm-1, λem = 527 = nm) bir aromatik yan zinciri ve Thr-203-His(Trp,Phe,Tyr) oyuncu değişikliği tarafından getirdiği gibi phenolate ile π istifleme etkileşimi, hangi ilâ 20'ye neden nm Kırmızı kaymıştır emisyon maxima (Thr-203-Tyr). Daha fazla ikame (Gln-69-Lys) sonuçları başka bir 1-2 nm red shift 529 için nm,11bilinen en kırmızı kaymıştır avGFP değişken. Sınıf IV, camgöbeği-floresan ECFP olduğu gibi bir indol (Tyr-66-Trp) için fenol alışverişini oluşturur (Ser-65-Thr/Tyr-66-Trp; λmax1 434 = nm, ε = 24,800 M-1cm-1; λmax2 452 = nm, ε = 23,600 M-1cm-1 ; λem1 = 477 nm, λem2 504 = nm). Hantal indol konaklama muhtemelen diğer, telafi edici mutasyonlar tarafından etkinleştirilir. ECFP uyarma ve emisyon maxima inbetween bu nötr veya Anyonik kromofor ile proteinlerin düşmek. Sınıf V proteinler liman fenol yerine bir imidazole (Tyr-66-O'nun), örn., mavi-floresan proteinler tarihlerde EBFP. Sınıf VI en mavi kaymıştır uyarma ve emisyon tepe pozisyonları için sonuç olarak uzaklaşan tarafsız chromophore formu sadece, lehine bir fenol fenil exchange tarafından üretilen (360 nm ve 442 nm, sırasıyla).

Klasik mutagenesis sitesi yönetmen roman avGFP chromophore türevleri, 65-67 tripeptit ve 20 kurallı amino asit çerçevesinde etkileşen artıkları ile permutasyon tarafından üretimi için özellikle uygundur. Kanonik olmayan aromatik amino asit türevleri ribozomal protein sentezi12sırasında tanıtıldı zaman bu olanakları daha da genişletilebilir. Prensip olarak, bunu yapmanın iki yolu vardır. İlk strateji protein çeviri makine, özellikle aminoasil tRNA sentetaz (aaRSs) ilgili amino asit analogları doğru substrat toleransı kullanır. Bu yüksek verimlilik, auxotrophic ulaşmak için E. coli ifade suşları karşılık gelen doğal amino asit sentez kuramayan istihdam edilmektedir. Bu ikinci değiştirme uygun kanonik olmayan amino asit (ncAAs) veya öncüleri bunların kültür ortamına ekleyerek sağlar. Bu strateji, olarak da bilinen seçici basınç birleşme (SPI)13,14, ncAA küresel birleşme sonucu kalıntı özel yedek sağlar. İkinci strateji kodonu kullanır ncAA tarafından tahsil edilir bastırıcı tRNA mühendislik aaRS enzimler. Bu çerçeve stop kodon readthrough içinde sonuçları ve siteye özgü ncAA birleşme sağlar. Sonuç olarak, bu yöntem stop kodonu bastırma (SCS) genetik kod15genişleme için yol açar. Mutagenesis bir kodonu hedef gen istenen sitesinde yerleştirilir. Prensip olarak, SPI da verilen bu nadir kurallı amino asitler Met veya Trp gibi değiştirme için seçilir rekombinant peptidler ve benzersiz bir ncAA yükleme taşıyan proteinler oluşturmak için kullanılabilir. TRP ile SPI yaklaşımlar analogları 4 - F-, - F - ve 6-F-Trp, 7-aza-Trp, 4-OH - ve 5-OH-Trp yanı sıra 4 - 5 ve 5-NH2de dahil olmak üzere büyük bir çeşitlilik ile çalışmak gösterilmiştir - Trp veya bile β (thienopyrrolyl) alanin türevleri16 ,17,18,19,20. Böylece, SPI GFP kromofor aromatik amino asitleri daha fazla spectra ve bu FPs Stokes kayması terzi imkanı keşfetmek için kanonik olmayan türevleri tarafından yerine son derece avantajlı olabilir. Tüm protein sıra değişiklikleri gelince, FP katlama ve chromophore olgunlaşma ile uyumluluk deneysel olarak test edilmelidir.

Bu çalışmada, biz sınıf IV ECFP21vahşi tipli avGFP Tyr, onun chromophore Triad'ın içinde bir Trp kalıntı yerine taşır, kullanmaktadır. SPI kullanarak, bu Trp-66 (ve Trp-57, yalnızca diğer Trp kalıntı ECFP içinde) 4-amino-TRP tarafından konulur 4-amino-Trp chromophore içinde elektron amino grubu varlığı bir 108 nm Stokes kayması ile donatılmış bir heyecan durumu çok kırmızı kaymıştır proton transferi (ESPT) rezonans istikrar yanadır. Bu "altın" floresan protein (GdFP) maksimum floresan en büyük red shift ile değişken oluşturmaktadır (574 nm) tüm avGFP kaynaklı proteinler arasında. Biz GdFP protein üretim SPI tarafından yöntemi açıklar ve protokoller için elde edilen değiştirilmiş proteinlerin analiz zorunlu kütle spektroskopisi tarafından sağlar. Ayrıca, nasıl GdFP kullanılan olabilir ve zaman çözüldü Floresans spektroskopisi yaklaşımlar analiz göster.

Protocol

1. dönüşüm Trp auxotrophic E. coli

  1. Kimyasal olarak dönüştürmek veya electrocompetent (50 µL) bir Trp auxotrophic e.coli suşu e.ghücreleri. ATTC 49980 (WP2, E. coli zorlanma B/R22türetilmiş mutant), ısı şok veya çoğalmasıyla, sırasıyla kullanarak pQE - 80 L His6-ECFP plazmid, 1 ng/µL sulu çözüm 1 µL ile. Lütfen ayrıntılar için Jüpiter bilim eğitim veritabanı23,24 bakın.
    Not: İfade vektör bir N-lac operatörüyle bakteriyel T5 Organizatör tarafından tahrik ölümcül 6 x O'nun öğesini ECFP21 pQE - 80L His6-ECFP kodlar. Daha fazla bir AmpR seçim işaretçisi ve çoğaltma colE1 kökeni taşır (pQE - 80 L vektör omurga dizi bulunabilir: https://www.qiagen.com/mx/resources/resourcedetail?id=c3b71572-4d82-4671-a79b-96357fe926d1&lang=en & autoSuggest = true). Kuramsal Moleküler ağırlığı (sonra chromophore olgunlaşma25) His6-ECFG vahşi tipi proteinin 28303.92 Da var. Çevrilmiş hedef protein (O'nun altı çizili, etiketi vektör elde edilen serilerinde kalın) aşağıdaki gibi sırasıdır: MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMK
    QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGS
    VQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK.
  2. 10 g/M glikoz, 100 µg/mL Ampisilin ile desteklenmiş LB-Ağar kaplamalar (Tablo 1) dönüştürülmüş hücrelerdeyse plaka ve plaka 37 ° C'de gecede kuluçkaya.

2. rekombinant Protein ifade

  1. E. coli ATCC 49980 pQE - 80 L His6-ECFP gecede kültür
    1. 5 mL LB orta de hazırlamak (Tablo 1; 10 g/M glikoz, 100 µg/mL Ampisilin ile desteklenmiş) steril 14 mL polistren kültür tüp için aerobik büyüme ve ile aşılamak bir koloni steril pipet ucu veya aşı döngü kullanarak bir agar plaka tek başına.
      Not: kolonileri taze dönüştürülmüş hücrelerin kullanılması önerilir. (Kimden adım 1.2.) bakteri kolonileri pilakalar 4 ° C'de birkaç gün boyunca saklanır.
    2. Orbital Çalkalayıcı 200-250 rpm'de 37 ° C'de hücreler gecede kuluçkaya.
  2. Vahşi tipli ECFP ifade
    1. 10 mL taze LB orta aşılamak (Tablo 1; 10 g/M glikoz, 100 µg/mL Ampisilin ile desteklenmiş) 100 ml Erlenmeyer flask gecede kültür 100 µL ile. Şişesi 200 devirde bir orbital Çalkalayıcı 37 ° C'de kuluçkaya.
      Not: İsteğe bağlı olarak, bu adım 10 mL NMM19 orta (Tablo 1) 100 µg/L Ampisilin ve 0,5 mM L-triptofan ile gerçekleştirilebilir (indol alternatif olarak, kullanılabilir).
    2. 600 optik yoğunluk ölçmek her 20 dk. tercihen ölçmek nm (OD600) hücre yoğunluğu 600 tükenme belirlenerek nm (OD600) her zaman bir yol uzunluğu 1 cm. ile bir küvet kullanarak bir Spektrofotometre gerçekleştirmek bir başvuru karşılık gelen Kültür ortamı kullanarak ölçüm. Örnekleri ve örnekleri 0.1-0,8 ölçüm değerini elde etmek için o zaman OD600 seyreltme faktörü kullanarak hesaplamak mix oranında seyreltin. Detaylar için lütfen önceki yayın 26için bakın.
    3. Aşırı doz ulaşan üzerine600 değeri 0,5-0,8 (yaklaşık 2-3 saat sonra aşı), SDS-sayfa için (Sodyum Lauryl Sülfat polyacrylamide Jel Elektroforez, adım 4) "önce indüksiyon" örnek al.
    4. Sıvı kültürü 0,5 mM IPTG (izopropil β-D-1-thiogalactopyranoside, 1 M hisse senedi çözümden) olarak ayarlayarak hedef protein ifade teşvik ve 4-8 h için bir orbital Çalkalayıcı-200 devirde 30 ° C'de kuluçkaya.
      Not: Camgöbeği floresan proteinler2737 ° C altındaki sıcaklıklarda yaygın olarak ifade edilir.
    5. Örnek "sözcüğünden sonra ifade" SDS-sayfa için (Adım 4) al.
    6. Bakteri hücreleri tarafından 5000 x g ve 4 ° c de 10 dakika aralıklarla hasat
    7. Decanting tarafından süpernatant atmak ve hücre granül-20 ° C veya-80 ° C hedef protein arıtma kadar dondurma.
  3. GdFP üretimi için SPI
    1. 10 mL NMM19 orta (Tablo 1) 100 µg/mL Ampisilin, 15 µM triptofan ve 100 ml Erlenmeyer flask gecede kültür 10 µL ile takıma aşılamak ve kültür şişeye gecede 30 ° C'de bir orbital shaker 200 devirde kuluçkaya.
      Not: Çeşitli kimyasal olarak tanımlanan medya E. coli ve SPI ekimi için kullanılabilir. NMM, burada kullanılan ek olarak BEZLERİ orta28, glikoz-mineral tuzlar orta29, Davis en az orta30, M9 en az orta31veya GMML32 -ebilmek var olmak kullanılmış.
    2. Değeri 0,05 den fazla 30 dk daha az tarafından sadece dönüşünceye kadar ertesi gün, OD600 her 30 dakikada ölçmek. Plato değeri yaklaşık 1 olmalıdır.
      Not: Sapmalar ± 0,3 birimleri tarafından kabul edilir. Bakteriyel zorlanma ve kullanılan orta bağlı olarak, ilk triptofan konsantrasyonu (adım. 2.3.1) ayarlaması gerekebilir.
    3. "Önce indüksiyon" örnek SDS-sayfa için (Adım 4) al.
    4. Bakteri hücreleri tarafından 5000 x g ve 4 ° c de 10 dakika aralıklarla hasat Süpernatant decanting tarafından atmak.
    5. Hücreleri NMM19 orta 100 µg/mL Ampisilin ile 10 ml 100 mL Erlenmeyer şişesi resuspend ve 4-amino-indol 1 mM 50 mM hisse senedi çözüm kullanarak son bir konsantrasyon için ekleyin. Orbital Çalkalayıcı 200 devirde 30 ° C'de 30 dk için kuluçka devam.
      Not: Bu adım Ampisilin düşük Kimyasal kararlılığı nedeniyle önerilir ve hücresel 4-amino-indol alımını sağlar.
    6. Hedef protein ifadesi 0,5 mM 1 M stok kullanarak son bir konsantrasyon IPTG ekleyerek teşvik ve örnek bir gecede 30 ° C'de bir orbital shaker 200 devirde kuluçkaya.
      Not: Camgöbeği floresan proteinler2737 ° C altındaki sıcaklıklarda yaygın olarak ifade edilir.
    7. Ertesi gün, OD600ölçmek.
    8. Örnek "sözcüğünden sonra ifade" SDS-sayfa için (Adım 4) al.
    9. Bakteri hücreleri tarafından 5000 x g ve 4 ° C de 10 dakika aralıklarla hasat ve süpernatant decanting tarafından atın.
    10. Böyle bir gemi Santrifüjü için kullanılmadı diye, hücre Pelet bir spatula kullanarak bir 50 mL konik polistren tüp aktarın. -20 ° C veya-80 ° C hücre Pelet hedef protein arıtma kadar dondur.

3. hedef Protein saflaştırma immobilize Metal iyon benzeşme Kromatografi (IMAC) üzerinden

  1. Bakteri hücre lizis
    1. 10-20 dakika buzda hücre Pelet çözülme.
    2. Hücre Pelet buz gibi bağlama arabellek (Tablo 1) 5 mL buza kullanarak bir 50 mL konik polistren tüp resuspend.
    3. 20 µL 50 mg/mL lizozim, 1 mg/ml ben ve 1 mg/ml RNase A. 20 µL tüp, 5 kez ters çevirme karışımı yavaşça kapatıp 30 dk için buz üzerinde tutmak Dnaz 20 µL ekleyin.
      Not: Lizozim tarafından katalize kısmi hücre bozulması oluşur.
    4. Tarafından rüşvet buz 2 tarafından soğutmalı bir 15 mL polistren tüp 3 dk. üç döngüleri kullanarak bir ultrason homogenizer ucu kullanarak sonification algılama hücreleri parçalayıcı s darbe, 4 Genlik Duraklat ve % 45 s.
      Not: Alternatif olarak, yüksek basınçlı homojenizasyon kullanılabilir, örn., 20 döngüsü sırasında 14.000 psi. Gerekirse, en az enstrüman birim ulaşmak için bağlama arabellek kullanarak oranında seyreltin. Ayrıca, protein ayıklama reaktifler hücre bozulması için kullanılabilir. Örnekler için malzemeler tablosuna bakın.
    5. Örnek için 15.000-18.000 x g, 4 ° c'de 30 dk santrifüj kapasitesi
    6. Süpernatant taze tüp ve not etmek aşağı sıvı cilt içine aktarın.
    7. Çözüm bir 5 mL plastik radarı kilit şırınga ve bir polivinilidin florid (PVDF) şırınga filtresi kullanarak 0,45 µm şırınga filtre ile filtre.
    8. "Lysate" örnek SDS-sayfa için (Adım 4) al.
    9. Hücre enkaz Pelet (eski lysate olarak eşit miktar) GKD2O resuspend.
    10. Örnek "Pelet" SDS-sayfa için (Adım 4) alın.
  2. IMAC arıtma
    1. 1 prepacked veya kendi kendine IMAC FPLC (hızlı protein sıvı Kromatografi) sütun üreticinin yönergelerine uygun Paketli mL kullanın. Sütun denge de lysate hücre sütun için uygulandıktan sonra izleyen yıkama adım gelince için bağlama arabellek (Tablo 1) kullanın.
    2. Toplamak ve havuzu eluate kesirler ile görünür ışık altın rengine göre tanımlanan GdFP.
      Not: İsteğe bağlı olarak, hedef protein doğrusal imidazole degrade kullanarak eluted (0-250 mM) otomatik FPLC sistemi kullanarak.
    3. Geçersiz kalma katsayısı 466, edebiyat değeri kullanarak protein konsantrasyonu belirlemek nm (ɛ466 nm 23,700 M-1 cm-1=)33 elüsyon arabelleği referans olarak ile. Prosedür hakkında ayrıntılar için lütfen önceki yayın26için bakın.
    4. SDS-sayfa için örnek "eluate" alabilir ve 1-10 µg lane Coomassie boyama durumunda başına protein kullanın.
      Not: SDS örnek tutarlarını boyama yöntemi ve boya duyarlılık bağlı olarak değişebilir.
    5. Diyaliz diyaliz arabellek veya MS arabelleği bir molekül ağırlığı ile kesme (MWCO) 5.000-10, 000 bir membran kullanarak karşı eluate kesirler bir aliquot. Diyaliz membran üretici yönergelerine göre hazırlayın. 1 mL örnek için en az 2 h 100 mL tampon karşı üç kez diyaliz. Bu yordam hakkında daha fazla bilgi için lütfen önceki yayın34için bakın.
    6. İçin depolama, protein örnek diyaliz arabelleği-80 ° C'de dondurmak
      Not: Aliquots en az 6 ay için kararlı olmalıdır.

4. SDS-sayfa örnek E. coli tüm cep telefonu özü hazırlanması

  1. Bir hücre süspansiyon için 1 mL OD600 eşdeğer transfer 1 süspansiyon = (e.g. 500 µL OD600= 2) 1.5 mL microcentrifuge tüp içine.
  2. Hücreleri tarafından 5000 x g, oda sıcaklığında 10 dakika aralıklarla hasat. Süpernatant pipetting tarafından atmak.
  3. GKD2O 80 µL ekleyip 20 µL 5 x SDS pipetting tarafından hücre Pelet ve mix boya tampon (Tablo 1) yükleme.
  4. Isıtma ile 95 ° C arasında bir su banyosu veya ısı blok 5 min için tarafından hücreleri denatüre. Daha sonra oda sıcaklığına örnekleri serin.
  5. 10 µL Coomassie lekeli SDS-sayfa önceki yayın35göre kullanın.
    Not: SDS örnek tutarlarını boyama yöntemi ve boya duyarlılık bağlı olarak değişebilir.

5. sağlam Protein kitle analiz Electrospray iyonlaşma uçuş zaman kütle spektrometresi için (LC-ESI-TOF-MS) birleştiğinde tarafından yüksek performanslı sıvı Kromatografi (HPLC)

Not: HPLC degrade, ayarları ve arabellek ayırma sütun ve enstrüman kullanılan bağlı olarak farklı olabilir. Örnek teşkil eden donanımlar için malzeme tablosuna bakın.

  1. Protein konsantrasyonu bir örnekten diyaliz karşı MS tampon (Adım 3.2.3.) kullanarak yukarıda açıklandığı gibi belirlemek MS arabellek (bkz: malzemeler tablo) referans olarak.
  2. 0.1 mg/ML 80 µL son bir birimi olarak MS arabellek kullanımı protein örnek sulandırmak, dikkatli pipetting tarafından mix, çözüm MS otomatik örnekleyici şişe cam eklemek ile içine aktarmak ve bir kap ile kapatın. Hava kabarcıkları şişeyi flicking tarafından kaldırın.
  3. İkinci bir Otomatik Örnekleyici şişe cam Ekle (arabellek boş) olmadan MS arabellek 1 mL ile doldurulması.
  4. Isınmak araç sağlar. Aleti kalibrasyon gerçekleştirin. Yeterli miktarda sıvı Kromatografi-grade çözücüler kullanılabilir olduğundan emin olun (> 100 mL).
  5. Doğrusal 20 dk HPLC degradeye %5 %80 arabellek bir (%0,1 formik asit GKD2O), kombine ile tampon B programı (Asetonitril %0,1 formik asit).
  6. HPLC 0.3 mL/dak bir akış başlatın ve sütun basınç stabil olana kadar bekleyin.
  7. Bir Otomatik Örnekleyici enjeksiyon hacmi 5 µL LC-ESI-TOF-Bayan yöntemi için ayarlayabilir, çalıştırmak bir boş bir örnek çalışması tarafından takip için bir worklist oluşturmak ve karşılık gelen Otomatik Örnekleyici şişe pozisyonlar atayabilirsiniz. Worklist çalıştırın.
  8. Worklist bitirdikten sonra oluşturulan örnek veri dosyasını açın. Toplam iyon geçerli (TIC) arsa deconvolution için bir aralık seçin ve maksimum entropi deconvolution algoritmasıyla MS spektrum deconvolute.
    Not: deneysel koşullar bağlı olarak ek türler sigara olgunlaştı FP oluşabilir veya arabellek iyon adducts.

6. Floresans ömür boyu ölçümleri ve çürüme ilişkili Spectra (DAS) GdFP

Not: zaman çözüldü Floresans spektroskopisi araçları için için örnek teşkil eden donatım Malzemeleri tablo için bakınız. Absorbans yanı sıra Floresans uyarma ve emisyon spectra floresan proteinlerin Ayrıca laboratuvar UV/Vis ve Floresans Spektrofotometreler kullanarak kaydedilebilir.

  1. GdFP dalga boyu çözüldü Floresans ömür boyu ölçümü
    1. 2 mL GdFP tarafından seyreltme PBS arabellek (Tablo 1) pH 7 içine bir 1 µM çözeltisi hazırlamak. Çözüm 1 cm kuvars küvet doldurun.
    2. PS Geniş puls 470 nm lazer için örnek uyarma ve 488 nm uzun taramalı emisyon filtre yüklemek ve 600 L/mm ızgara36 (TWCSPC) dedektörü dalga boyu rejimi edinimi için sayma zaman ve dalga boyu ilişkili tek fotonun ayarlamak 500-700 nm.
    3. Yaklaşık 103 sayıları Floresans çürüme eğrileri edinme en fazla yazılım sayma tek foton ile birikmiş olan kadar floresan emisyon yaklaşık 200 x 103 fotonlar/sn sayısı oranında elde etmek.
  2. Enstrümantal yanıt işlevi37 (IRF) ölçümü
    1. PBS tampon pH 7 örnek küvet 1 g/L kolloidal silis (~ 220 m2/g) ile dolu bir 1 cm kuvars küvet ile değiştirin.
      Not: 400 g/L sulu süspansiyon kullanarak silika süspansiyon hazırlanır.
    2. 488 nm uzun taramalı emisyon filtre ve 100 x 103 sayıları/s altına TWCSPC bulmak-e doğru sayısı hızla ayarlamak için INSERT gri filtreleri kaldırın.
    3. Izgara 470 nm fotonlar Kanal 8 16 kanal TWCSPC Dedektör edinimi için ayarlayın.
    4. Yaklaşık 10 x 103 sayıları en fazla emisyon birikmiş kadar IRF elde etmek.
    5. Convert Floresans çürüme eğrileri ve IRF ASCII veri dosyalarına küresel ile38 program uygun.
    6. Kuralları Global, yaşam süreleriyle bağlantılı parametre olarak üç üstel bileşenleri toplamı bir modele göre uygun.
    7. Arsa çürüme spectra (DAS) bireysel çürüme bileşenleri genlik dağılımları dalga boyu bağımlılık olarak veri analiz yazılımı ile ilişkili.

Representative Results

Seçici basınç şirketleşme tekniği kullanarak, Trp-66 ECFP (ve Trp-57, yalnızca diğer Trp kalıntı ECFP içinde) chromophore triad ' 4-amino-Trp tarafından böylece farklı spektral özellikleri ile kırmızı kaymıştır GdFP üreten değiştirilebilir. Kütle spektrometresi kanonik olmayan amino asit istenen stokiometrik entegrasyon içine protein, şekil 1' de gösterilen sonuçları ile göstermek için kullanılması gerekir. Daha sonra mikroskopi, UV-Vis soğurma spektroskopisi yanı sıra GdFP fluorophore pH bağımlılığının odaklanarak özelliklerini tanımlamak için kararlı durum ve zaman ve dalga boyu çözüldü Floresans spektroskopisi verileri sağlamanız Spectra.

4-amino-Trp tarafından ECFP iki Trp kalıntılarında alışverişini onaylamak için kitle spektrometrik analizi yapılır. Şekil 1 GdFP bir temsilcisi deconvoluted ESI-MS spektrum gösterir. Vahşi tipi ECFP chromophore olgunlaşma sonra 28,283.9 Da hesaplanan protein kütleye sahip iken, GdFP karşılık gelen kitle 28,313.9 Da değil. GdFP deconvoluted ESI-MS spektrumu 28,314.1 ± 0,1 bir ana kitle zirvesinde sergileyen teorik değerden az 10 ppm tarafından sapma Da. Bu tür bir analiz25için tipik doğruluk aralığı içinde olmak, bu ncAA SPI ile birleşme doğrular (vahşi tipi ECFP için deneysel değer: 28,283.7 Da).

Şekil 2 confocal floresan görüntüleme mikroskobu (CFIM) görüntüleri bakteriyel hücre ECFP, EGFP, EYFP ve GdFP resuspension PBS arabellek bakteri üzerine ifade gösterir. Tüm görüntüleri bir UV objektif ve lazer uyarma her örnek için aynı enerji hakkında ile donatılmış bir mikroskop elde.

Şekil 3A GdFP, her zaman çok benzer uyarma enerji (boyları Şekil 2gibi) ile izlenen dahil olmak üzere çeşitli FPs ifade E. coli bakteri CFIM görüntülerin bir yerleşim gösterir. Şekil 3B gösterilen FP türevleri chromophore yapıları gösterir. ECFP için karşılaştırıldığında GdFP parlaklığını ile ilgili olarak (floresan kuantum verimi φ = 0,4), EGFP (φ 0.6 =) ve EYFP (φ 0.6 =) bu GdFP için satın alma daha geniş bir floresan ışığın unutmamak gerekir (30 nm) 20 aksine kullanılan diğer spe için kullanılan nm CIES, benzer değerleri resimlere yoğunluğunu ayarlamak için. Biraz daha düşük bir tükenme katsayısı ve azaltılmış kuantum verimi sonucu olarak benzersiz photophysical özellikleri ile GdFP parlaklığını gösterilen diğer FPs kıyasla daha düşük.

ECFP (şekil 3 c) soğurma spektrumu 434 iki karakteristik maxima vardır nm ve 452 nm. Buna ek olarak, GdFP bir geniş kırmızı kaymıştır emme bant 466 vasıl en yüksek derece ile karakterize nm. EGFP emilimini daha da kırmızı-488 için kaymıştır nm. Ancak, çok daha büyük Stokes kayması GdFP nedeniyle (108 nm) ECFP için karşılaştırıldığında (41 nm) ve EGFP (20 nm), GdFP emisyon spektrum en kırmızı-kaydırılır araştırıldı burada tüm üç GFP türevlerinin (şekil 3D) olduğunu. ECFP floresan emisyon 475 iki karakteristik maxima gösterirken nm ve 505 nm, EGFP olan bir geniş ana emisyon grubu 508 peaking nm (λmax) ile hafif bir omuz, 540 nm. GdFP floresan yaklaşık 565 görünür nm (λmaks.) (Şekil 3D). Ayrıca 475 adlı küçük bir omuz olarak görünür olan vahşi tipli ECFP küçük bir katkı kendi emisyon spektrum içeren nm. Bu küçük ECFP kesir olarak açıklanan33SPI yordamı sırasında indüksiyon önce sentezlenir.

Şekil 3E GdFP Absorpsiyon spektrumu pH bağımlı değişiklikleri gösterir. 5 bir pH değişiklik 8, maksimum emisyon biraz kırmızı vardiya ve hafif bir emme grubun genişletme görülmektedir. Ancak, emme genlik azalma sadece pH 8 ve pH tarafından modifiye GdFP chromophore zemin durumu özellikleri çok zayıf olduğunu gösteren pH 5, arasında yaklaşık % 10 olduğunu.

Zaman tek foton sayarak izlenen Floresans emisyon şekil 4' te gösterilen çözüldü. 550 merkezli spektral kanallarında izlenen çürüme eğrileri nm ve 600 nm (şekil 4A) sergi biraz daha hızlı bir floresan çürüme 600 nm 550, çürüme karşılaştırıldığında nm. Floresans küresel bir uyum sonuçlarını çürüme eğrileri iki üstel bileşenleri sonuçlarında iki hayalice ayırt Floresans çürüme bileşenleri zamanı sabitleri ile 1.0 ile ns ve 3,3 ns (şekil 4 c ve D).

Birçok floresan protein çeşidi GFP aile için tipik olarak GdFP floresan emisyon şiddetle pH üzerinde bağlıdır. Şekil 4B GdFP floresan emisyon pH 5 ve spektral özellikleri sabit kalırken gösteren açıkça bir düşüş floresan yoğunluğu düşük pH pH 8, arasında karşılaştırır.

GdFP çürüme ilişkili spectra (DAS)39 (şekil 4 c ve D) iki farklı emisyon grup tarafından karakterize edilmektedir. Yavaş 3.3 katkısını ns bileşeni daha da belirgin kısa dalgaboyu aralığında yaklaşık 550 nm (% 60) daha hızlı bileşeni (% 40) küçük bir katkı ile. 600 nm, her iki bileşenin var aynı genlik hakkında. PH vardiya üzerine çok az 7 (şekil 4 c) pH 6 (şekil 4 d), spektral özellikleri Das olarak değiştirmeniz ve zaman sabitler küresel uygun rutin gelen da aynı (DAS zamanı sabitleri doğruluğu ± 0,15 ns hakkında olduğunu) vardır. Ancak, mutlak genlikleri iki DAS bileşenleri arasındaki farkı açıkça belirgindir hangi tam olarak azaltılmış Floresans emisyon genlik şekil 4Baynı pH vardiyada üzerine hesapları.

Figure 1
Şekil 1: GdFP temsilcisi deconvoluted ESI-MS spektrumu. GdFP (altın rengi, iç metin gösterilen büyütülmüş arsa) ESI-MS spektrum 28314.1 Da ana pik gösterir (hesaplanmış değer 28313.9 Da). Spektrum vahşi tipi ECFP için siyah olarak gösterilir. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 2
Şekil 2: bakteriyel nüfus çeşitli FPs ifade Confocal floresan mikroskopi görüntülerden. Aşağıdaki dalga boyu ayarları resim alma için kullanıldı: ECFP (λex 457 = nm, algılama: 461-480 nm), EGFP (λex 488 = nm, algılama: 495-515 nm), GDFP (λex 476 = nm, algılama: 560-590 nm), EYFP (λex 514 = nm, algılama: 520-530 nm). Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 3
Şekil 3: spektral özelliklerine GdFP. Bakteri hücreleri bakteri PBS arabelleği resuspension sonra ECFP, EGFP ve GdFP ifade karışımı (A) CFIM görüntüsü. (B) Chromophore yapıları GdFP (ile 4-amino-Trp kalıntı 66 yerine), ebeveyn ECFP (ile Trp pozisyonda 66) ve EFGP (ile Tyr pozisyonda 66). GdFP, ECFP ve EGFP, normalleştirilmiş soğurma spektrumları karşılaştırılması (C) ise (D), ECFP normalleştirilmiş Floresans emisyon spektrumu (uyarma, 430 nm) floresan emisyon spectra için EGFP ve GdFP (her ikisi de karşılaştırılır heyecanlı 450 nm). (E) pH-bağımlılık emme spectra ürününün (280 emme normalleştirilmiş nm). Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 4
Şekil 4: zaman çözüldü Floresan, GdFP. (A)floresan GdFP çürüme izlenen zaman - ve dalga boyu-çözüldü tarafından tek foton 550 merkezli spektral kanalları sayma nm ve 600 nm (± 12,5 nm) uyarma 470 nm lazer bakliyat ile sonra. Enstrümantal yanıt işlevi (IRF) kullanılan kurulum zaman çözünürlüğü hakkında bilgi sağlar. (B) varyasyon GdFP pH üzerinde bağımlı emisyon spektrumu (460, uyarma nm). (C, D) Çürüme ilişkili spectra (DAS) GdFP, pH 7 (C) ve pH zaman ve dalga boyu çözüldü floresan deconvolution bozunmaları sonra belirlenen 6 (D) ve yaşlılık ile iki Üstel Fonksiyonlar genel bir dizi tarafından tüm kanallarda genel provası bağlantılı zaman sabitler. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Figure 5
Şekil 5: yapıları ECFP (siyah) ve GdFP (altın) kromofor intramolecular ücret transferi. NcAA parçası olarak amino grubunun chromophore sistemi iyi elektron donör tarafından boyutunu artış rezonans sabitleme heyecan durumu elde etmek için daha Mesomerik yapıları oluşumunu sağlar. FP iskele bağlantı noktalarına semicircles gösterilir. Bu rakam daha büyük bir versiyonunu görüntülemek için buraya tıklayınız.

Hisse senedi çözüm konsantrasyon, çözelti Not
% 20 D-glikoz 200 g/L D-glikoz GKD2O Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
indol isopropanol 50 mM
4-amino-indol % 20 etanol (100 mL GKD2ile O kadar dolu son hacmi 20 mL etanol) 50 mM
IPTG GKD2O 1 M
L-triptofan 15 mM çözünmüş GKD21 M HCl kullanarak O (HCl dropwise toz dissoved kadar karıştırma altında Ekle)
lizozim 50 mg/mL GKD2O
Dnaz ben 1 mg/mL GKD2O
RNase A 1 mg/mL GKD2O
Amp100 100 mg/mL Ampisilin GKD2O
Sodyum-dodecylsulfate (SDS) 200 g/L GKD2O
Amonyum sülfat ((NH4)2SO4) GKD2O 1 M tarafından ısıyla sterilize
Potasyum dihydrogen fosfat (KH2PO4) GKD2O 1 M tarafından ısıyla sterilize
di-potasyum hidrojen fosfat (K2HPO4) GKD2O 1 M tarafından ısıyla sterilize
Magnezyum sülfat (MgSO4) GKD2O 1 M tarafından ısıyla sterilize
D-glikoz GKD2O 1 M Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
Sodyum Klorür (NaCl) GKD2O içinde 5 M tarafından ısıyla sterilize
Kalsiyum klorür (CaCl2) 1 g/L Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
iron(II) klorür (FeCl2) 1 g/L Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
Tiamin 10 g/L Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
biotin 10 g/L Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
eser elementler mix Bakır sülfat (CuSO4), Çinko Klorür (ZnCl2), mangan klorür (MnCl2), amonyum molibdat ((NH4)2MoO4); GKD2O her 1 mg/L Filtrasyon tarafından 0,45 µm gözenek boyutu şırınga filtre sterilize
19 amino asit karışımı 1.) 0.5 g L-fenilalanin ve toz eriyene kadar karıştırarak altında 1 M HCL 100 ml GKD2O dropwise eklenmesi ile 0.5 g L-tirozin geçiyoruz.
2.) tartmak her (L-triptofan dışında) kalan L-amino asit 0.5 g dışarı. Mix 22 mL fo ile 1 M KH2PO4 ve 1 M K2HPO448 mL. GKD2O yaklaşık 800 mL için ekleyin. Çözüm açık hale gelinceye kadar karıştırın.
3.) Ekle çözünmüş L-fenilalanin ve L-tyrosine adım 1.) ve 1 M'ye GKD2O. ile ses seviyesini
4.) Sterilize amino asit karışımı bir şişe en iyi filtre ünitesi ile vakum filtrasyon sayesinde.
Arabellekleri ve medya Kompozisyon/hazırlık
SDS boya tampon yükleme, 5 x konsantre 0.25 M Tris pH 6.8, % 50 v/v gliserol, % 0,25 w/v bromphenol mavi, 0, 5 M didhiothreitol (DTT; alternatif olarak %5 β-mercaptoethanol), % 10 w/v sodyum-dodecylsulfate (SDS)
Bağlama arabellek 50 mM sodyum dihydrogenphosphate (NaH2PO4), 500 mM NaCl, 10 mM imidazole, pH 8
elüsyon arabellek 50 mM sodyum dihydrogenphosphate (NaH2PO4), 500 mM NaCl, 250 mM imidazole, pH 8
Diyaliz arabellek 50 mM sodyum dihydrogenphosphate (NaH2PO4), 150 mM NaCl, 100 mL/L gliserol, pH 8
MS arabellek 10 mM Tris-HCl, pH 8
L-triptofan (NMM19) dışında 19 L amino asitler içeren yeni en az orta Aşağıdaki son konsantrasyonları elde etmek için tüm hisse senedi çözümler mix: 7.5 mM (NH4)2SO4, 1.7 mM NaCl, 22 mM KH2PO4, 50 mM K2HPO4, 1 mM MgSO4, 20 mM D-glikoz, 50 mg/L 19 amino asitler karıştırın, 1 µg/L CaCl2, 1 µg/L FeCl2, 10 µg/L Tiamin, 10 mg/L biotin, 0.01 mg/L eser elementler mix
LB orta Kompozisyon: 10 g/L tryptone, 5 g/L Maya ekstresi, 10 g/M NaCl, pH 7,0 GKD2O
Hazırlanışı:
1.) tartmak 50 gr tryptone dışarı, 25 gr Maya ekstresi, 5 g NaCl içine 1 L cam şişe.
2.) Ekle ddH2O kadar ~ 800 mL ve erime bileşenleri karıştırma altında.
3.) ölçmek pH ve pH 7 1 M HCl veya 1 M NaOH, dropwise eklenmesi tarafından ayarlayın. 1 L. ddH2O Ekle
4.) Sterilize ısıyla tarafından daha sonra cilt kaybı için denetleyin ve gerekirse telafi etmek için steril GKD2O ekleyin. 4 ° C'de kullanmak kadar saklamak.
LB Ağar kaplamalar Kompozisyon: 10 g/L tryptone, 5 g/L Maya ekstresi, 10 g/M NaCl, 15 g/L agar-agar, pH 7,0 GKD2O
Hazırlanışı:
1.) tartmak 50 gr tryptone dışarı, 25 gr Maya ekstresi, 5 g NaCl, 7.5 g agar-agar 1 L cam şişe içine.
2.) Ekle GKD2O kadar karıştırma altında 500 mL ve erime bileşenleri.
3.) ölçmek pH ve pH 7 1 M HCl veya 1 M NaOH, dropwise eklenmesi tarafından ayarlayın. 1 L. ddH2O Ekle
4.) Sterilize ısıyla tarafından daha sonra cilt kaybı için denetleyin ve gerekirse telafi etmek için steril GKD2O ekleyin. (Not: LB agar 4 ° C'de LB Ağar kaplamalar hazırlanması kullanıma kadar saklanabilir. Bir mikrodalga kullanarak dikkatle eritebilir katılaşmış agar)
5. çözüm olduğunda) hala sıcak (30-40 ° C), Ampisilin 100 µg/mL nihai bir konsantrasyon için ekleyin
6.) pour adım 5 sıvıdan yaklaşık 15 mL.) bir steril 10 cm Petri kabına steril koşullarda. Ne zaman agar katılaşmış, tabaklar 4 ° C'de 1 hafta kadar kullanmak saklanır.
fosfat tamponlu tuz çözeltisi (PBS) Kompozisyon: 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 1 mM CaCl2, 0,5 mM MgCl2, pH 7. Isıyla veya filtrasyon tarafından sterilize.

Tablo 1: çözüm ve tampon stok.

Discussion

Çok yüksek ncAA birleşme verimliliği elde etmek için ncAA karşılık gelen doğal muadili sentezlemek mümkün değildir metabolik olarak mühendislik konak hücreleri kullanımına auxotrophy tabanlı SPI yöntemi dayanıyor. E. coliiçin böyle suşları kolayca kullanılabilir. Birden çok ncAAs bile aynı anda birleşme aynı protein içine multiauxotrophic suşları kullanarak mümkün olduğunu. Kalıntı özel modu değiştirme ve benzer kimyasal analogları için sınırlı kimyasal repertuar dezavantajları görülebilir. Yine de, doğal bakteriyel çeviri cihazı çok sayıda amino asit analogları'nin tolerans göstereceği gibi çok sayıda protein türevleri üretilebilir. Örneğin, 50'den fazla ncAAs proteinler vitro çeviri, genetik kod yeniden atamaya40için kullanılabilir olması için tüm kodon yaklaşık % 73 için muhasebe kullanarak içine dahil. Ayrıca, SPI Ayrıca verimli birden fazla site hedef protein41' etiketleme izin verebilirsiniz. Prensip olarak, SPI metodoloji E. coliiçin sınırlı değildir, ancak auxotrophic suşları ve tanımlanmış yetiştirme ortamı kullanılabilir olması koşuluyla herhangi bir diğer ana ve kurallı 20 amino asitler, herbiri için çalışabilir. Örneğin, iki metiyonin analogları, azidohomoalanine (Aha) ve homopropargylglycine (Hpg), ticari olarak kullanılabilir ve protein ve proteomes çeşitli organizmalarda etiketleme için kullanılır. Buna ek olarak, Aha intracellularly üretilen ve daha sonra protein42dahil. Bu ncAA özellikle bioorthogonal conjugations olarak Tirrel ve arkadaşları tarafından geliştirilen tıklayın kimya gibi için uygundur: Örneğin, Arabidopsis thaliana, doku Bombiks mori larva43, Drosophila bitki hücreleri44, larva Zebra balığı45 gibi memeli hücreleri nöronlar46de dahil olmak üzere, proteinler Aha47,48ile etiketli. Benzer şekilde, Trp analogları başarıyla Trp auxotrophic Lactococcus lactis suşları49antimikrobiyal peptidler içine dahil edilmiştir. SPI, alan hangi temel kimyasal makyaj yaşam alternatifleri araştırıyor bildireceğim50,51, için de kullanışlıdır. Örneğin, E. coli52 ve B. subtilis53önceki çalışmalarına bağlı olarak, bir E. coli zorlanma son zamanlarda thienopyrrole yerine kullanmak için seçici basınç ile evrimsel bir strateji was gelişmiş yanında indol, triptofan Proteom çapında ikame tarafından thienopyrrole-alanin genetik kod54yılında sonuçlanan. Genellikle, çok sayıda kimyasal varyasyonları sunuyor indol kimya zengin yönleriyle nedeniyle protein mühendisliği için umut verici bir hedef kurallı amino asit bir tek üçlüsü (UGG) tarafından kodlanır, Trp sunar. Son zamanlarda ve SPI tabanlı birleşme, alternatif olarak SCS platformu Trp analogları site-specifically bakteriyel ve ökaryotik ana bilgisayar içinde birleştirmek için yetenekli oldu bir roman55bildirdi. Bu daha fazla vivo içinde ncAA tabanlı protein Mühendisliği, spektral özellikleri değişiklik de dahil olmak üzere araç genişletiyor.

Auxotrophic ifade ana bilgisayarları kullanım yanı sıra, SPI Protokolü sıkı fermantasyon koşulları, hedef ifade zamanlama ve orta yüksek ncAA birleşme verimlilik ve hedef protein verim ulaşmak için kompozisyon açısından hem de gerektirir. 56. yetiştirme yürütülen aslında yanı sıra büyük tuzları kaynakları için azot (amonyum tuz) ve karbon (D-glikoz), vitaminler ve eser elementler içerir kimyasal olarak tanımlanan en az medya kullanımı. Kesinlikle daha fazla auxotrophies, kalan amino asitler olmaması durumunda gerekli, ancak (20 - n amino asitler değiştirilmesi için isen,) yaygın Bakteriyel büyüme57tanıtmak için eklenir. İndüksiyon hedef protein ifade önce bir ilk büyüme aşamasında değiştirilecek kurallı n amino asitler konsantrasyonları sınırlama eklenir. Hedeflenen temel amino asitleri tükenmiş, deneysel olarak belirtilen tarafından sabit bir OD600kadar hücre büyümesinde gerçekleştirilir. Daha sonra kültür orta tükenmiş amino asit yoksun ve ncAA bol konsantrasyonlarda içeren taze orta yerini alır. Bu protokol için gösterildiği gibi triptofan analogları ribozomal birleşme için analog bir indol beslenen intracellularly karşılık gelen triptofan türev triptofan synthase58tarafından dönüştürülmüş olur. Ardından, hedef protein ifadesi indüklenen. Bu aşamada, toplam cep telefonu numarasını ve fitness arasında bir denge olarak Logaritmik büyüme sonuna yakın hücrelerdir. Varlığı ve kurallı birleşmesiyle amino vahşi tipi protein üretimi için yol açacak gibi esansiyel amino asit tamamen indüksiyon öncesinde tükenmiş emin olmak önemlidir. Aynı şekilde, ncAA birleşme hedef protein içine verimliliğini sık tarafından kütle spektrometresi incelemek için zorunludur. Kurallı amino asit, yetiştirme koşulları ayarlanması gerek, ilk büyüme aşaması için gerekli amino acid(s) konsantrasyonu ve ikinci süresini değiştirme tarafından örneğin,'ın önemli varlığı durumunda. NcAA doğru düşük aaRS etkinlik halinde yürütülen59endojen enzim overexpression veya doğru ncAA daha etkin olan farklı bir aaRS ortak ifade olabilir.

Trp üç dikkat çekici özellikleri ile donatılmış kurallı amino asit: (i) onun doğal bereket proteinler düşük; (II) biyofiziksel ve kimyasal özellikleri benzersiz (örn., genellikle protein ve peptidler içsel Floresans baskın kökenli olup) ve (iii) biyokimyasal etkileşimleri çeşitli için katkıda bulunur ve işlevleri de dahil olmak üzere Π istifleme, H-bağ ve ba * π etkileşimleri. Tüm bu özellikler kökten Trp → 4-amino-Trp ikame GdFP. ötesinde şüphe üzerine değişti, avGFPs "altın" sınıfının tasarımını terzi autofluorescent proteinler mühendislik için dikkate değer bir örnektir. Farklı spektral özellikleri ile FPs doğru belirli spektral pencere eşiği mutagenesis ve ncAA birleşme yolu ile ayarlanabilir. GdFP durumunda, bu basit bir kimyasal takas H → NH2 çerçeve içinde bulunan ECFP chromophore Triad'da indol halka tarafından gerçekleştirilir. Şekil 5 ncAA birleşme chromophore içinde etkilerini görüntüler. 4-amino-(intracellularly 4-amino-Trp için dönüştürülür) indol kaynaklanan elektron grubu giriş stabilize bir heyecan durumu açıklayabilir Mesomerik yapıları çeşitli sağlar. Spectroscopically, onun genişlemiş Stokes kayması ve kırmızı kaymıştır Floresans emisyon genişletilmiş konjuge sistem bu belirgin özelliklerinden neden. Olarak daha önce gelişmiş intramolecular şarj transfer GdFP chromophore içinde doğal olarak pH (şekil 4B) hassas olduğunu bildirdi ve S0 zemin ve S1 arasında dipol an daha büyük bir değişiklik eşliğinde heyecanlı devlet göreli ECFP33. Alternatif elektron grupları olarak hidroksi gruplarıyla yerine bir indol yüzüğü triptofan analogları, karşılaştırmalı bir çalışma modeli protein barstar41ile rapor olarak kullanılabilir.

GdFP emme ve floresan spectra ECFP ve EGFP karşılaştırıldığında genişletilmesi (şekil 3 c ve D). Homojen emme ve floresan grupları genişletme genellikle chromophore titreşim modları tarafından ve ayrıca, chromophore daha fazla titreşim modları içinde protein60mevcut bağlantı tarafından neden olur. Bağlantı yerel protein ortamına chromophore üzerinde lokalize ücretleri tarafından desteklenmektedir. Yapısal inhomogeneity protein vibronic spektrum için bulunduğunuz yol açar gibi böyle kaplin chromophore vibronic spectra ve diğer protein arasındaki ücret delocalization ve içinde belirtildiği gibi Mesomerik Türkiye tarafından desteklenmektedir Şekil 5. Bu bağlantı da büyük Stokes kayması çekmek ve mutlaka Floresans kuantum verimi azaltır. Diğer kırmızı değiştirdi FPs ile karşılaştırıldığında, GdFP bile geliştirilmiş protein istikrar ve toplama33,61,62için düşük bir eğilim gösteriyor. Bu sadece diğer FP türevleri renginden farklı ama aynı zamanda önemli ölçüde artış thermostability ve gelişmiş kooperatif33katlama sergiler. Floresans şiddeti en az % 90 60 ° c, Isıtma üzerine ECFP floresan için yaklaşık % 30 azalır iken korunmuş olduğunu. Proteinler, aromatik amino asitler kez ağları genellikle protein üçüncül yapı teskin bir etkisi etkileşen yan zincirlerinin katkıda bulunur. avGFP chromophore kadar Phe-165, O'nun-148 de Tyr-145 olarak kendini oluşan böyle bir yan zinciri ağ, liman. Bu yan zincirler sadece GdFP yapısı33oldukça katı değildir ama önemlisi, onlar chromophore ile hidrofobik kişiler formu. GdFP içinde tanımlanan en önemli roman özelliği aminated chromophore Phe-165 için daha proksimal olmasıdır. Bu etkileşim içinde bilinen diğer avGFPs gözlenen değil bir özelliktir. İki artıkları 3.2-4.5 Å ayrı olduğundan, aromatik amino etkileşimler de bulunabilir. Chromophore amination kaynaklı rezonans istikrar ile birlikte, bu büyük olasılıkla bu hidrofobik ağ amino asitlerin bir kooperatif moda stabilize. Daha etkili bir intramolecular ücret transfer bu etkileşimler chromophore yere durumla karşılaştırmasını heyecanlı ve devlet tarafından desteklenen ve en azından kısmen 108 nm Stokes kayması33,62 için hesapları .

Fluorophore özellikleri rasyonel tasarımında, delocalized π sisteminin boyutunda bir artış içinde kırmızı kaymıştır uyarma dalga boyu neden tahmin edilmektedir. Bu kural için tarafsız kromofor pozisyon 66 önde gelen amino asitlerin dizi itaat: Phe (λmax 355 = nm) < onun (λma x386 = nm) < Tyr (λmax 395 = nm) < Trp (λmax = 436 nm)63. Doğada, bu uzantı π-Tahvil chromophore'nın konjuge sisteminin farklı stratejileri ile elde etti. Discosoma striataüzerinden DsRed için ek bir amino asit, böylece λmax 573 nm64' e değişen entegrasyona genişletilir. AsFP595 chromophore (λmax = 595 nm) Anemonia sulcata kendi π-sistem65büyütme imino bir grup tarafından genişletildi. Chromophore GdFP ve diğer avFPs aynı boyutta olduğundan, farklı bir ilke genişletilmiş DsRed ve asFP595 kromofor aralığında bir emisyon dalga boyu yol açmak gerekir. 108 derin Stokes kayması nm autofluorescent proteinlerin tasarımında yeni bir photophysical ilke ortaya GdFP chromophore farklı yapısına atfedilir. Ön hesaplamaları ( 62yılında bildirilen) olarak GdFP heyecanlı-devlet chromophore dipol an önemli ölçüde zemin devlet ECFP ilgili değerleri aksine daha büyük olduğunu göstermiştir. Oysa GdFP dipol anı S0 devlet ~ 3 d (Debye) 15 D ~ S1artırır, değişim ECFP chromophore için oldukça ılımlı (~ 4 d ~ 6 D). Böylece, GdFP benzersiz altın Floresans önemli intramolecular ücret transferi için rezonans istikrar sağlar (bkz şekil 5) mümkün Mesomerik yapıları çeşitli artar chromophore içinde neden olur. Bu emisyon oluştuğu enerji düzeyini azaltır. Dipol anda uyarma üzerine derin değişim sonucu olarak Elektrostatik potansiyel chromophore çevre değişiklikleri asıl nedeni intramolecular şarj ayrılmasıdır. Çevreleyen protein matris, buna karşılık, yetkili Dağıtım chromophore uyarma sonra değişiklikleri için ayarlar. Sonraki yapısal gevşeme nedeniyle ücret transferi karakter kırmızı Floresans spektrum vardiya heyecanlı chromophore enerji düzeyini düşürür. Aynı nedenle, büyük Stokes kayması ve radiationless süreçlerin GdFP floresan kuantum verimi arttırmak oranları sonucu olarak azaltılmış ECFP33' e kıyasla.

Yüksek kuantum verimi ve ECFP ve EGFP küçük Stokes kayması genellikle bir serbestlik azaltan chromophore, katı protein ortamına atfedilen ve sonuç olarak, heyecan devlet ışınımsal gevşeme lehine iç dönüşüm 66. sonuç olarak, kalan protein matris için azaltılmış MANŞONLA daha katı biçimde katıştırılmış kromofor moleküler tasarımını daha uzağa kırmızı kaymıştır GFP türevleri yüksek Floresans kuantum verimi ile üretmek için bir rehber olarak hizmet verebilir. Bu nedenle, daha fazla kırmızı kaymıştır autofluorescent proteinleri üretmek için yaklaşımlar mühendislik için π-elektron sistem ve protein ortamına kaplin zayıf katı chromophore yapısıyla son derece arzu edilir. Bu değişiklikler de GFP tabanlı kromofor doğrudan veya istenen ncAAs chromophore bölgede yerleşimini tarafından tanıttı.

Disclosures

Yazarlar onlar rakip hiçbir mali çıkarları var bildirin.

Acknowledgments

Bu eser F.-js için Alman Araştırma Vakfı tarafından (küme mükemmellik "birleştirici kavramları içinde kataliz) T.F. ve NB ve Federal Milli Eğitim Bakanlığı ve bilim (BMBF Program"HSP 2020", TU-WIMIplus proje SynTUBio) tarafından desteklenmiştir

Materials

Name Company Catalog Number Comments
Chemicals
4-aminoindole Sigma-Aldrich 525022
acetonitrile VWR HiPerSolv CHROMANORM ULTRA for LC-MS, 83642 LC-MS grade required
agar-agar Carl Roth 5210
ammonium molybdate ((NH4)2MoO4) Sigma-Aldrich 277908
ammonium sulfate ((NH4)2SO4) Sigma-Aldrich A4418
ampicillin sodium salt Carl Roth K029
biotin Sigma-Aldrich B4501
bromophenol blue Sigma-Aldrich B0126
calcium chloride (CaCl2) Sigma-Aldrich C5670
colloidal silica Sigma-Aldrich Ludox HS-40, 420816
Coomassie Brillant Blue R 250 Carl Roth 3862
copper sulfate (CuSO4) Carl Roth CP86.1
D-glucose Carl Roth 6780
di-sodium hydrogen phosphate (Na2HPO4) Carl Roth X987
di-potassium hydrogen phosphate (K2HPO4) Carl Roth P749.1
1,4-dithiothreitol (DTT) Carl Roth 6908
DNase I Sigma-Aldrich D5025
ethanol Carl Roth 9065.1
formic acid VWR HiPerSolv CHROMANORM for LC-MS, 84865 LC-MS grade required
glycerol Carl Roth 3783
imidazole Carl Roth X998
indole Sigma-Aldrich I3408
iron(II) chloride (FeCl2) Sigma-Aldrich 380024
isopropanol Carl Roth AE73.1
isopropyl β-D-1-thiogalactopyranoside (IPTG) Sigma-Aldrich I6758
lysozyme Sigma-Aldrich L6876
magnesium chloride (MgCl2) Carl Roth KK36.1
magnesium sulfate (MgSO4) Carl Roth 8283.2
manganese chloride (MnCl2) Sigma-Aldrich 63535
β-mercaptoethanol Carl Roth 4227.3
potassium chloride (KCl) Carl Roth 6781.3
potassium dihydrogen phosphate (KH2PO4) Sigma-Aldrich P5655
RNase A Carl Roth 7156
sodium chloride (NaCl) Carl Roth P029
sodium dihydrogen phosphate (NaH2PO4) Carl Roth T879
sodium dodecyl sulphate (NaC12H25SO4) Carl Roth 0183
thiamine Sigma-Aldrich T4625
Tris(hydroxymethyl)-aminomethane (Tris) Carl Roth 5429
Tris hydrochloride (Tris-HCl) Sigma-Aldrich 857645
tryptone Carl Roth 8952
yeast extract Carl Roth 2363
zinc chloride (ZnCl2) Sigma-Aldrich 229997
Name Company Catalog Number Comments
amino acids
L-alanine Sigma-Aldrich A7627
L-arginine Sigma-Aldrich A5006
L-asparagine Sigma-Aldrich A8381
L-aspartic acid Sigma-Aldrich A0884
L-cysteine Sigma-Aldrich C7352
L-glutamic acid Sigma-Aldrich G2128
L-glutamine Sigma-Aldrich G3126
L-glycine Sigma-Aldrich G7126
L-histidine Sigma-Aldrich H8000
L-isoleucine Sigma-Aldrich I2752
L-leucine Sigma-Aldrich L8000
L-lysine Sigma-Aldrich L5501
L-methionine Sigma-Aldrich M9625
L-proline Sigma-Aldrich P0380
L-phenylalanine Sigma-Aldrich P2126
L-serine Sigma-Aldrich S4500
L-threonine Sigma-Aldrich T8625
L-tryptophan Sigma-Aldrich T0254
L-tyrosine Sigma-Aldrich T3754
L-valine Sigma-Aldrich V0500
Name Company Catalog Number Comments
Lab materials
0.45 µm syringe filter with PVDF membrane Carl Roth CCY1.1
1.5 mL microcentrifuge tubes Eppendorf 30120086
conical polystyrene (Falcon) tubes, 50 mL Fisher Scientific 14-432-22
Luer-Lock syringe 5 mL Carl Roth EP96.1
dialysis membrane, Molecular Weight Cut-Off (MWCO) 5,000 Spectrum Medical Industries Spectra/Por MWCO 5000 dialysis membrane, 133198
Immobilized Metal ion Affinity Chromatography (IMAC) column 1 mL, Ni-NTA Macherey Nagel Protino series, 745410.5
petri dishes (polystyrene, sterile) Carl Roth TA19
pQE-80L plasmid vector Qiagen no longer available replaced by N-terminus pQE Vector set Cat No./ID: 32915
protein extraction reagent BugBuster EMB Millipore 70921-4
round-bottom polystyrene tubes, 14 mL Fisher Scientific Corning Falcon, 14-959-1B
Trp-auxotrophic E. coli strain ATCC ATCC 49980 Bridges BA et al., Chem Biol Interact., 1972, 5(2):77-84; see main text for alternatives
Name Company Catalog Number Comments
Mass Spectrometry equipment
mass spectrometer for LC-ESI-TOF-MS Agilent Agilent 6530 Accurate-Mass QTOF coupled with Infinity LC system
mass spectrometry data analysis software Agilent MassHunter Qualitative Analysis software v. B.06.00
High-Performance Liquid Chromatography (HPLC) column for LC-ESI-TOF-MS Sigma-Aldrich Supelco Discovery BIO Wide Pore C5 HPLC column, 3 µm particle size, 10 cm x 2.1 mm
HPLC autosampler vials 1.5 mL Sigma-Aldrich Supelco 854165 with conical 0.1 mL glass inserts, screw caps and septa
Name Company Catalog Number Comments
General equipment
benchtop centrifuge for 1.5 mL Eppendorf tubes Eppendorf 5427 R
cooling centrifuge for 50 mL Falcon tubes Eppendorf 5810 R
high pressure microfluidizer for bacterial cell disruption Microfluidics LM series with “Z” type chamber
peristaltic pump for LC GE Healthcare P-1
Fast Protein Liquid Chromatography (FPLC) system GE Healthcare ÄKTA pure 25 L
orbital shaker for bacterial cultivation Infors HT Minitron
UV/Vis spectrophotometer Biochrom ULTROSPEC 2100
ultrasonic homogenizer for bacterial cell disruption Omnilab Bandelin SONOPULS HD 3200, 5650182 with MS72 sonifier tip
Name Company Catalog Number Comments
Fluorescence spectroscopy equipment
ps-pulsed laser 470 nm Picoquant GmbH PDL-470
time- and wavelength-correlated single photon counting (TWSPC) acquisition software Picoquant GmbH SymPhoTime 64
time- and wavelength-correlated single photon counting (TWSPC) detector Picoquant GmbH PML-16C 16 spectral channels, to be selected by grating settings
single photon counting software Picoquant GmbH SPCM 9.75
global fitting software Picoquant GmbH SPC2Glo(R)
fluorescence decay data analysis software Picoquant GmbH FluoFit program
data analysis software OriginLab Inc. Origin 9.2
neutral density filter set Schott NG1 to NG11 (400 - 650 nm, transmission 50 %, 20%, 10 %, 5 %)
488 nm long-pass emission filter AHF Analysentechnik AHF-488
quartz cuvette Thorlabs GmbH CV10Q1400 1 cm pathlength

DOWNLOAD MATERIALS LIST

References

  1. Shimomura, O., Johnson, F. H., Saiga, Y. Extraction, Purification and Properties of Aequorin, a Bioluminescent Protein from the Luminous Hydromedusan, Aequorea. J Cell Compar Physl. 59, (3), 223-239 (1962).
  2. Chalfie, M., Tu, Y., Euskirchen, G., Ward, W. W., Prasher, D. C. Green fluorescent protein as a marker for gene expression. Science. 263, (5148), 802-805 (1994).
  3. Andresen, M., et al. Structure and mechanism of the reversible photoswitch of a fluorescent protein. P Natl Acad Sci USA. 102, (37), 13070-13074 (2005).
  4. Andresen, M., et al. Structural basis for reversible photoswitching in Dronpa. P Natl Acad Sci USA. 104, (32), 13005-13009 (2007).
  5. Brakemann, T., et al. A reversibly photoswitchable GFP-like protein with fluorescence excitation decoupled from switching. Nat Biotechnol. 29, (10), 942-947 (2011).
  6. Kremers, G. -J., Gilbert, S. G., Cranfill, P. J., Davidson, M. W., Piston, D. W. Fluorescent proteins at a glance. J Cell Sci. 124, (Pt 2), 157-160 (2011).
  7. Shimomura, O. Structure of the chromophore of aequorea 0. shimomura green fluorescent protein. FEBS Lett. 104, (2), 220-222 (1979).
  8. Shaner, N. C., Campbell, R. E., Steinbach, P. A., Giepmans, B. N. G., Palmer, A. E., Tsien, R. Y. Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein. Nat Biotechnol. 22, (12), 1567-1572 (2004).
  9. Shcherbo, D., et al. Bright far-red fluorescent protein for whole-body imaging. Nat Methods. 4, (9), 741-746 (2007).
  10. Shcherbakova, D. M., Subach, O. M., Verkhusha, V. V. Red fluorescent proteins: advanced imaging applications and future design. Angew Chem Int Edit. 51, (43), 10724-10738 (2012).
  11. Stepanenko, O. V., Verkhusha, V. V., Kuznetsova, I. M., Uversky, V. N., Turoverov, K. K. Fluorescent proteins as biomarkers and biosensors: throwing color lights on molecular and cellular processes. Curr Protein Pept Sc. 9, (4), 338-369 (2008).
  12. Wang, L., Xie, J., Deniz, A. A., Schultz, P. G. Unnatural amino acid mutagenesis of green fluorescent protein. J Org Chem. 68, (1), 174-176 (2003).
  13. Budisa, N., Steipe, B., Demange, P., Eckerskorn, C., Kellermann, J., Huber, R. High-level biosynthetic substitution of methionine in proteins by its analogs 2-aminohexanoic acid, selenomethionine, telluromethionine and ethionine in Escherichia coli. Eur J Biochem. 230, (2), 788-796 (1995).
  14. Sharma, N., Furter, R., Kast, P., Tirrell, D. A. Efficient introduction of aryl bromide functionality into proteins in vivo. FEBS Lett. 467, (1), 37-40 (2000).
  15. Liu, C. C., Schultz, P. G. Adding new chemistries to the genetic code. Annu Rev Biochem. 79, 413-444 (2010).
  16. Twine, S. M., Murphy, L., Phillips, R. S., Callis, P., Cash, M. T., Szabo, A. G. The Photophysical Properties of 6-Azaindole. J Phys Chem B. 107, (2), 637-645 (2003).
  17. Lepthien, S., Hoesl, M. G., Merkel, L., Budisa, N. Azatryptophans endow proteins with intrinsic blue fluorescence. P Natl Acad Sci USA. 105, (42), 16095-16100 (2008).
  18. Budisa, N., et al. Probing the role of tryptophans in Aequorea victoria green fluorescent proteins with an expanded genetic code. Biol Chem. 385, (2), 191-202 (2004).
  19. Ross, J. B., et al. Spectral enhancement of proteins: biological incorporation and fluorescence characterization of 5-hydroxytryptophan in bacteriophage lambda cI repressor. P Natl Acad Sci USA. 89, (24), 12023-12027 (1992).
  20. Soumillion, P., Jespers, L., Vervoort, J., Fastrez, J. Biosynthetic incorporation of 7-azatryptophan into the phage lambda lysozyme: Estimation of tryptophan accessibility, effect on enzymatic activity and protein stability. Protein Eng Des Sel. 8, (5), 451-456 (1995).
  21. Heim, R., Tsien, R. Y. Engineering green fluorescent protein for improved brightness, longer wavelengths and fluorescence resonance energy transfer. Curr Biol. 6, (2), 178-182 (1996).
  22. Bridges, B. A., Mottershead, R. P., Rothwell, M. A., Green, M. H. L. Repair-deficient bacterial strains suitable for mutagenicity screening: tests with the fungicide captain. Chem Biol Interact. 5, (2), 77-84 (1972).
  23. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Bacterial Transformation: The Heat Shock Method. J Vis Exp. (2017).
  24. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Bacterial Transformation: Electroporation. J Vis Exp. (2017).
  25. Grigorenko, B. L., Krylov, A. I., Nemukhin, A. V. Molecular modeling clarifies the mechanism of chromophore maturation in the green fluorescent protein. J Am Chem Soc. (2017).
  26. JoVE Science Education Database. General Laboratory Techniques. Introduction to the Spectrophotometer. J Vis Exp. (2017).
  27. Goedhart, J., et al. Structure-guided evolution of cyan fluorescent proteins towards a quantum yield of 93%. Nat Commun. 3, 751 (2012).
  28. Neidhardt, F. C., Bloch, P. L., Smith, D. F. Culture medium for enterobacteria. J Bacteriol. 119, (3), 736-747 (1974).
  29. Hörnsten, E. G. On culturing Escherichia coli on a mineral salts medium during anaerobic conditions. Bioprocess Eng. 12, (3), 157-162 (1995).
  30. Davis, B. D. The Isolation of Biochemically Deficient Mutants of Bacteria by Means of Penicillin. P Natl Acad Sci USA. 35, (1), 1-10 (1949).
  31. Sambrook, J., Russell, D. W. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press. Cold Spring Harbor, NY, USA. (2001).
  32. Wang, Y. -S., et al. The de novo engineering of pyrrolysyl-tRNA synthetase for genetic incorporation of L-phenylalanine and its derivatives. Mol Biosyst. 7, (3), 714-717 (2011).
  33. Bae, J. H., et al. Expansion of the genetic code enables design of a novel "gold" class of green fluorescent proteins. J Mol Biol. 328, (5), 1071-1081 (2003).
  34. JoVE Science Education Database. Dialysis: Diffusion Based Separation. J Vis Exp. Cambridge, MA. (2017).
  35. JoVE Science Education Database. Basic Methods in Cellular and Molecular Biology. Separating Protein with SDS-PAGE. J Vis Exp. (2017).
  36. Petrásek, Z., et al. Excitation energy transfer from phycobiliprotein to chlorophyll d in intact cells of Acaryochloris marina studied by time- and wavelength-resolved fluorescence spectroscopy. Photoch Photobio Sci. 4, (12), 1016-1022 (2005).
  37. Kolber, Z. S., Barkley, M. D. Comparison of approaches to the instrumental response function in fluorescence decay measurements. Anal Biochem. 152, (1), 6-21 (1986).
  38. Pelet, S., Previte, M. J. R., Laiho, L. H., So, P. T. C. A fast global fitting algorithm for fluorescence lifetime imaging microscopy based on image segmentation. Biophys J. 87, (4), 2807-2817 (2004).
  39. Loefroth, J. E. Time-resolved emission spectra, decay-associated spectra, and species-associated spectra. J Phys Chem. 90, (6), 1160-1168 (1986).
  40. Hartman, M. C. T., Josephson, K., Lin, C. -W., Szostak, J. W. An expanded set of amino acid analogs for the ribosomal translation of unnatural peptides. PLoS One. 2, (10), e972 (2007).
  41. Budisa, N., et al. Global replacement of tryptophan with aminotryptophans generates non-invasive protein-based optical pH sensors. Angew Chem Int Edit. 41, (21), 4066-4069 (2002).
  42. Ma, Y., Biava, H., Contestabile, R., Budisa, N., di Salvo, M. L. Coupling bioorthogonal chemistries with artificial metabolism: intracellular biosynthesis of azidohomoalanine and its incorporation into recombinant proteins. Molecules. 19, (1), 1004-1022 (2014).
  43. Teramoto, H., Kojima, K. Incorporation of Methionine Analogues Into Bombyx mori Silk Fibroin for Click Modifications. Macromol Biosci. 15, (5), 719-727 (2015).
  44. Deal, R. B., Henikoff, J. G., Henikoff, S. Genome-wide kinetics of nucleosome turnover determined by metabolic labeling of histones. Science. 328, (5982), 1161-1164 (2010).
  45. Hinz, F. I., Dieterich, D. C., Tirrell, D. A., Schuman, E. M. Non-canonical amino acid labeling in vivo to visualize and affinity purify newly synthesized proteins in larval zebrafish. ACS Chem Neurosci. 3, (1), 40-49 (2012).
  46. Dieterich, D. C., et al. In situ visualization and dynamics of newly synthesized proteins in rat hippocampal neurons. Nat Neurosci. 13, (7), 897-905 (2010).
  47. Dieterich, D. C., Link, A. J., Graumann, J., Tirrell, D. A., Schuman, E. M. Selective identification of newly synthesized proteins in mammalian cells using bioorthogonal noncanonical amino acid tagging (BONCAT). P Natl Acad Sci USA. 103, (25), 9482-9487 (2006).
  48. Glenn, W. S., et al. Bioorthogonal Noncanonical Amino Acid Tagging (BONCAT) Enables Time-Resolved Analysis of Protein Synthesis in Native Plant Tissue. Plant Physiol. 173, (3), 1543-1553 (2017).
  49. Zhou, L., et al. Incorporation of tryptophan analogues into the lantibiotic nisin. Amino Acids. 48, (5), 1309-1318 (2016).
  50. Acevedo-Rocha, C. G., Budisa, N. Xenomicrobiology: a roadmap for genetic code engineering. Microb Biotechnol. 9, (5), 666-676 (2016).
  51. Agostini, F., Völler, J. -S., Koksch, B., Acevedo-Rocha, C. G., Kubyshkin, V., Budisa, N. Biocatalysis with Unnatural Amino Acids: Enzymology Meets Xenobiology. Angew Chem Int Edit. 56, (33), 9680-9703 (2017).
  52. Bacher, J. M., Ellington, A. D. Selection and characterization of Escherichia coli variants capable of growth on an otherwise toxic tryptophan analogue. J Bacteriol. 183, (18), 5414-5425 (2001).
  53. Wong, J. T. Membership mutation of the genetic code: loss of fitness by tryptophan. Pc Natl Acad Sci USA. 80, (20), 6303-6306 (1983).
  54. Hoesl, M. G., et al. Chemical Evolution of a Bacterial Proteome. Angew Chem Int Edit. 54, (34), 10030-10034 (2015).
  55. Italia, J. S., et al. An orthogonalized platform for genetic code expansion in both bacteria and eukaryotes. Nat Chem Biol. 13, (4), 446-450 (2017).
  56. Völler, J. -S., Thi To, T. M., Biava, H., Koksch, B., Budisa, N. Global substitution of hemeproteins with noncanonical amino acids in Escherichia coli with intact cofactor maturation machinery. Enzyme Microb Tech. 106, 55-59 (2017).
  57. Budisa, N., Steipe, B., Demange, P., Eckerskorn, C., Kellermann, J., Huber, R. High-level biosynthetic substitution of methionine in proteins by its analogs 2-aminohexanoic acid, selenomethionine, telluromethionine and ethionine in Escherichia coli. Eur J Biochem. 230, (2), 788-796 (1995).
  58. Völler, J. -S., Budisa, N. Coupling genetic code expansion and metabolic engineering for synthetic cells. Curr Opin Biotech. 48, 1-7 (2017).
  59. Johnson, J. A., Lu, Y. Y., Van Deventer, J. A., Tirrell, D. A. Residue-specific incorporation of non-canonical amino acids into proteins: recent developments and applications. Curr Opin Chem Biol. 14, (6), 774-780 (2010).
  60. Somsen, O. J., van Grondelle, R., van Amerongen, H. Spectral broadening of interacting pigments: polarized absorption by photosynthetic proteins. Biophys J. 71, (4), 1934-1951 (1996).
  61. Kurschus, F. C., Pal, P. P., Bäumler, P., Jenne, D. E., Wiltschi, B., Budisa, N. Gold fluorescent annexin A5 as a novel apoptosis detection tool. Cytom Part A. 75, (7), 626-633 (2009).
  62. Lepthien, S., Wiltschi, B., Bolic, B., Budisa, N. In vivo engineering of proteins with nitrogen-containing tryptophan analogs. Appl Microbiol Biot. 73, (4), 740-754 (2006).
  63. Wachter, R. M., Elsliger, M. -A., Kallio, K., Hanson, G. T., Remington, S. J. Structural basis of spectral shifts in the yellow-emission variants of green fluorescent protein. Structure. 6, (10), 1267-1277 (1998).
  64. Verkhusha, V. V., Lukyanov, K. A. The molecular properties and applications of Anthozoa fluorescent proteins and chromoproteins. Nat Biotechnol. 22, (3), 289-296 (2004).
  65. Martynov, V. I., Savitsky, A. P., Martynova, N. Y., Savitsky, P. A., Lukyanov, K. A., Lukyanov, S. A. Alternative cyclization in GFP-like proteins family. The formation and structure of the chromophore of a purple chromoprotein from Anemonia sulcata. J Biol Chem. 276, (24), 21012-21016 (2001).
  66. Piatkevich, K. D., Malashkevich, V. N., Morozova, K. S., Nemkovich, N. A., Almo, S. C., Verkhusha, V. V. Extended Stokes shift in fluorescent proteins: chromophore-protein interactions in a near-infrared TagRFP675 variant. Sci Rep. 3, (1), 1847 (2013).

Comments

0 Comments


    Post a Question / Comment / Request

    You must be signed in to post a comment. Please or create an account.

    Usage Statistics